KEGG   Tribolium castaneum (red flour beetle): 662258Help
Entry
662258            CDS       T01046                                 

Gene name
AChE-1
Definition
acetylcholinesterase 1
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tca00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
Position
LG5
AA seq 731 aa AA seqDB search
MWWRTRQCIRREAKLLTPEPSQSDWSCFSWIDFSLLSASTKIQSKLDEGESAVSKKRREP
KKVNLLASEHVTCRPYKSMTGAWAACLLVILLPSCIPSPHRGRHHPPEPHAEAYHMSRDP
FDPHRDSEEFRRDAPDDKREFTRRDSEDDPLVIQTKKGKVRGISLTAATGKKVDAWLGIP
YAQKPLGNLRFRHPRPAEKWEGVMNTTSQPNSCVQIIDTVFGDFPGATMWNPNTPLNEDC
LYVNVVVPKPRPTSAAVMVWVFGGGFYSGTNTLEVYDHNILVSEENIILVSMQYRVASLG
FLYFGTPDVPGNAGLFDQMMALQWVRDNIAAFGGNPNNITLFGESAGAVSVSLHLLSPLS
RNLFSQAIMESGSATAPWAIISREESILRGLRLAEAVGCPHERHELSAVIDCLKKKDPID
LVNNEWGTLGICEFPFVPVIDGAFLDESPTRALANKNFKKTNILMGSNTEEGYYFIIYYL
TELFRKEENVYVNRQEFLRAVTELNPYFNAISRQAIVFEYTNWLNPDDPVSNRDSLDKMV
GDYHFTCNVNEFAHRYAETGNTVYMYYYKHRTVANPWPSWTGVMHADEINYVFGEPLNPT
KSYTAQEVDLSKRIMRYWANFAKTGNPSQSPNGVWTPTFWPPHTAFGREFLTLDVNSTAT
GRGPRLKQCAFWKKYLPQLQQQTSKLLSSELLNQPPRQNCTDAASSLRWSRDGAAGLLMV
STVAALLAGPF
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggcgtactcggcagtgcatccgcagagaggccaaacttttgacccccgaaccc
tcacaatccgattggtcgtgcttctcttggatcgatttttctctgctttccgcgtcgact
aagattcaatctaaattagatgagggagagagtgcagtgtcaaaaaaaagacgagagccg
aagaaggttaatttactggcgagtgaacacgtgacttgtcgcccatacaaatcgatgacg
ggagcgtgggcggcctgcttactagtgattctacttccctcatgcatcccttcgccacac
cgaggccgccaccacccccccgagcctcacgccgaggcctaccacatgtcccgcgacccc
ttcgacccgcaccgggactcggaggagttccgacgagacgccccggacgacaagcgggag
tttacgcgtcgcgactccgaagatgatcccctggtcatccagacaaagaaagggaaagtc
cgcggcatctccctcacggccgccacgggaaagaaggtcgacgcgtggctgggaatcccc
tacgcgcagaaaccgctcggcaacctccggttccggcacccgcggcctgcggaaaagtgg
gagggcgtgatgaacacgactagccagccgaattcctgcgtgcagattatagacacagtg
tttggggatttcccaggtgcgaccatgtggaaccccaacacaccgttgaacgaagactgt
ctttacgtgaacgtggtggtgccgaagccgaggccgaccagtgccgcggtcatggtgtgg
gtgttcgggggtgggttctactccgggacgaacactttagaagtttacgaccacaacata
ctagtgtccgaagagaacattattttagtttcgatgcagtatagagttgcttcgctcgga
ttcctgtatttcgggacgccggacgttccgggaaatgcaggattgtttgaccaaatgatg
gcgttgcaatgggtacgtgataacatcgccgctttcggaggaaaccccaacaatatcact
ctattcggagaatcagcaggagctgtttcagtctccctgcatctactctctccattatcg
agaaacctattctcacaagctatcatggaatctgggagtgcgacagcaccttgggctata
atctcccgtgaagaaagcattttgcgaggattgagactagcagaagctgtgggttgtccg
catgagcgccacgagctttccgctgttatagactgcttaaaaaagaaagaccctattgat
ttagtcaataacgaatggggaacactcggcatatgtgagtttccgttcgtcccagtcatt
gatggagcctttctggacgaatcccccacacgggctctggcaaacaaaaacttcaaaaaa
accaatatcctcatgggttctaacacagaagaaggctactacttcataatctactacttg
accgaactgttccgaaaggaggagaacgtttacgtcaaccggcaggaattcctgcgggct
gtaaccgaactgaacccgtacttcaacgcgatttcgcgccaagcaatcgtcttcgaatac
accaactggttaaaccccgacgacccggtgagcaaccgcgactccctcgataaaatggta
ggcgactaccacttcacttgcaacgtcaacgaattcgcccaccggtacgccgaaaccggc
aacacggtctacatgtactactacaagcaccggacagtggcgaatccctggccctcctgg
accggcgtgatgcacgccgacgaaatcaactacgtcttcggggaaccactcaatcccact
aaaagctacacagcacaagaagtcgatctgagtaagcgaatcatgagatactgggccaat
ttcgccaagacgggcaacccgagtcagtcgccgaacggcgtttggacacccactttctgg
cccccgcacacagctttcggaagggagtttctcaccctcgatgtcaactccactgccaca
gggaggggacctagactcaagcagtgtgccttctggaagaaatacctacctcaacttcag
cagcaaacgagtaagttgctgtcaagcgagcttctgaaccaaccgccccggcaaaactgt
accgacgcggccagttcgttgcgatggtcaagagacggcgctgccggcctcctgatggtg
tcgacagtggcggcgctcctcgcggggcctttctaa

DBGET integrated database retrieval system