KEGG   Tribolium castaneum (red flour beetle): 662295Help
Entry
662295            CDS       T01046                                 

Gene name
eIF-4E
Definition
eukaryotic initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    662295 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    662295 (eIF-4E)
Messenger RNA biogenesis [BR:tca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     662295 (eIF-4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     662295 (eIF-4E)
Translation factors [BR:tca03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    662295 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 210 aa AA seqDB search
MSSNSIESENEKNDLKTENDIDIAQDFSIKHPLQNCWTLWYYENDRSQTWEKNQKEIASF
QTVEDFWSLYNHIKPASELRQGNDYSLFKRGIRPMWEDEANKRGGRWLINLDKKQRTNEL
DRYWLDIILCLIGEAFEHSDEICGAVVNIRGKGDKIGVWTSDATKSAAVIEIGKKLKERL
HIPPRTVLGYQIHKDTQDKSGSVTKNSYTV
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaattcgatagaaagcgagaacgaaaaaaacgacctaaagactgagaacgac
atagacatcgcgcaggatttttccatcaaacacccgctccaaaactgctggacactttgg
tactacgagaatgacaggagccagacgtgggagaagaaccagaaggaaatcgcctcgttt
cagaccgttgaggacttctggagtttatacaatcacattaagcccgcaagtgagctgaga
caagggaacgactattccctgttcaagaggggcatcaggcccatgtgggaggatgaagcg
aacaaacgcggggggcgttggcttattaacttagacaagaaacagaggaccaacgagctt
gaccggtactggcttgatattatcttgtgtctaattggggaagcgttcgagcattcggat
gaaatctgcggggcggtagtcaatattcgaggaaagggtgataagatcggggtctggact
tccgacgccacaaaaagcgcggctgtcatcgaaatcggcaaaaaactgaaggagcggctg
catataccgccaaggacggttttaggataccaaatccacaaagacactcaggacaagtct
ggttccgttaccaagaattcatacaccgtttaa

DBGET integrated database retrieval system