KEGG   Tribolium castaneum (red flour beetle): 662334Help
Entry
662334            CDS       T01046                                 

Definition
28S ribosomal protein S18b, mitochondrial
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Ribosome [BR:tca03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    662334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 188 aa AA seqDB search
MAMLSSIIVKNLPENPLWKRTFTISAAFRASETALSAEPRLEVREITKDRSKPIPVETSI
RYLKSAAYRQTYGDQPVWVLYRRNHKGAIPPRKTRKTCIRGDQISCGNPCPICRDEYLVL
HENNVELLKQFVCEHTGSILSYSKTGLCQKKHQQLLVAIRRAVDSGLLTFDVPHRHYNYS
EFYPELKQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttatcctcaataattgtgaagaatttacccgagaaccccttatggaaacgc
acttttaccatatcggcagcattcagagcatcagaaacggccttatctgctgagccaagg
ctcgaagttcgcgaaataaccaaagaccgctcgaaacccatccccgttgagacaagtata
aggtacctaaagagcgccgcttaccggcaaacgtacggcgaccagcctgtgtgggtcctg
taccgacgaaaccacaaaggggctatcccccccaggaaaacacggaaaacctgcattcgg
ggggaccaaatttcgtgcgggaacccctgtcccatctgccgggacgagtacttggtttta
cacgaaaataacgtagaattgcttaaacagttcgtctgtgaacacactggtagtattttg
agttattccaaaactgggttgtgccaaaagaagcaccaacagttgctagtggcgattcga
agggctgtggacagcggactgctcacctttgatgtgccgcaccgacactacaattattcc
gaattttaccccgaactgaagcaataa

DBGET integrated database retrieval system