KEGG   Tribolium castaneum (red flour beetle): 662336Help
Entry
662336            CDS       T01046                                 

Definition
trifunctional enzyme subunit alpha, mitochondrial
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    662336
   01212 Fatty acid metabolism
    662336
  Carbohydrate metabolism
   00640 Propanoate metabolism
    662336
   00650 Butanoate metabolism
    662336
  Lipid metabolism
   00062 Fatty acid elongation
    662336
   00071 Fatty acid degradation
    662336
   01040 Biosynthesis of unsaturated fatty acids
    662336
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    662336
   00310 Lysine degradation
    662336
   00380 Tryptophan metabolism
    662336
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    662336
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     662336
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     662336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 761 aa AA seqDB search
MSTLRFFGALSKISRTNIKFKNTAQIRGMASQERKHTKLKVVDNIGVIVLDSPGVKVNSL
NGEVMGEFGSVLHEIESNPQIQAAVLISAKPNCFIAGADITMLEKCQSAEEATKISREGQ
EMLAAIESSNKPIVAAIQGSCLGGGLEVALSCHYRIAVKDKKTGLGLPEVMLGLLPGAGG
TQRLPRLSTVPNALDMSLTGKTLKADRAKKMGIVDLLVDPLGPGLGEPETVTRQYLESVA
VDVAKQLASGKLKVDRKKSQLTDRLLEFALQYNWVKDQIFGKAKAQVMKMSGGLYPAPLR
ILEVIRTGIDKGPKAGYEAEARAFGELAMTPQSKGLMGLFRGQTECKKNRFGKPSKEVKT
VAVLGAGLMGAGIAHVSVDKGYNVILKDTNPVGLARGLGQIQNGLQNAVKRKRLTGLERD
RFLSNLDATLDYKNFKKADIVIEAVFEDLNIKHKVVKEVEAIIPPECVFATNTSAIPISK
IAAASSRPDKVIGMHYFSPVDKMQLLEIITTDKTSKDTTALAVDVGLKQGKVVITVGDGP
GFYTTRILSAMMAESVRLLQEGVDPKELDSLTKKFGFPVGAATLADEVGLDVASHIGPDL
LKAFGERFGGGDMGVMRDIVQAGFLGRKSGKGIYVYEKGSKSRSVNHEALDIIKRYSVEP
KGAFEDEDKQLRMVSRFVNEAILCLEEKILANPLEGDIGAVFGLGFPPFTGGPFRWVDSF
GADRLVFKMEEFQKAYGLPFKPAQTLMDMAKDNSKKFYPRK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacactacggttttttggggccttatcgaaaatttcccgtactaacataaagttt
aagaacacagcacaaatccgcggcatggcctcacaggagaggaagcacacgaagctcaaa
gttgtggataatattggagtcatagtcttagactcgccaggagtcaaagtgaactctttg
aatggcgaagtaatgggcgagttcggctccgtcctgcacgagatcgagtccaacccccag
atccaagccgcagtattaatctccgccaaacccaactgtttcatcgcaggcgccgacatt
accatgttggaaaagtgtcaatcggccgaagaagccacaaaaatatcacgcgaaggtcaa
gaaatgctcgccgctatcgaaagtagcaacaaaccgatcgttgccgcaattcaaggctca
tgtcttggtggtgggctcgaagttgcactgtcctgccattacagaattgcagtcaaagac
aaaaaaaccgggctaggtttgccggaagttatgttggggcttctgccaggagctggaggc
actcagcgtttgccccgtctgagcaccgttccaaatgctttagatatgagcttgactgga
aagactttgaaggcggatcgagcgaaaaaaatgggaattgttgacttattggttgatcct
ttgggacctgggttgggtgaacccgaaactgtcacgagacagtatttggaatcggtggcg
gttgatgttgccaaacagttggccagtggaaaattgaaagttgataggaagaagtcccag
cttacagataggcttttggagtttgctttgcagtacaattgggtcaaggatcagattttt
ggaaaggccaaagcccaagttatgaaaatgtccggagggctgtatccagctccgcttagg
attttggaagttattcgaactgggattgacaagggccccaaggccggttacgaggccgaa
gctcgcgctttcggtgagcttgcaatgaccccgcagtctaaaggtttgatgggtttgttc
cgcggccaaaccgaatgcaagaaaaaccgtttcggaaaaccgtcaaaagaagttaaaact
gttgccgttttgggagctggtttgatgggtgccggcatagcccatgtctcagttgataaa
ggctataatgttattctgaaagacacaaatccggtgggtttggcacgtggacttggacaa
attcaaaatggtttgcaaaatgccgttaaaaggaagagacttactggactggagagggac
cgatttttgtcaaatctagacgcaactcttgactataaaaatttcaaaaaggctgatatt
gtaattgaggctgttttcgaagacctaaacattaaacataaagtcgtgaaagaggtcgaa
gcgattattcccccagaatgcgtttttgcaacaaacacaagcgctattccaatttccaaa
attgcggcagcttcgtccaggccagataaagttataggcatgcattatttttcacccgtc
gacaaaatgcagcttttggaaatcatcaccactgacaaaacgagcaaagacaccacagcc
ctggccgtggatgtaggtctaaagcaaggaaaagtggtgattacggtgggagacggccct
ggtttttacacaactcgcattttatccgccatgatggcagaatccgtaagactgctccag
gaaggtgtcgaccctaaagaactggattccttgacgaagaaattcggtttccctgtaggt
gccgccactttggccgacgaagtcggtttggacgtagcctcacacattggacccgacctt
cttaaagcttttggcgaaagattcggaggaggtgacatgggggtcatgcgggacatcgtc
caggccggtttcctaggccgcaagtctggcaaaggcatctacgtgtacgaaaagggaagc
aagagccgtagcgtgaaccacgaagctttggatataatcaagcgttattcggtcgagccg
aagggtgcgtttgaggatgaggataagcagttgaggatggtgtcgagattcgtgaatgag
gcgattttgtgcttggaggagaagattttggcgaatcctctcgagggagacattggtgca
gtattcgggttgggcttcccgccattcactggaggaccgttccgctgggtggactcgttc
ggtgctgataggttggtgtttaagatggaggagttccagaaagcctacggattgcccttc
aaaccggctcaaactttgatggatatggcgaaggataactccaagaagttctatccgcgc
aagtga

DBGET integrated database retrieval system