KEGG   Tribolium castaneum (red flour beetle): 662336Help
Entry
662336            CDS       T01046                                 

Definition
(RefSeq) trifunctional enzyme subunit alpha, mitochondrial
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00062  Fatty acid elongation
tca00071  Fatty acid degradation
tca00280  Valine, leucine and isoleucine degradation
tca00310  Lysine degradation
tca00380  Tryptophan metabolism
tca00410  beta-Alanine metabolism
tca00640  Propanoate metabolism
tca00650  Butanoate metabolism
tca01040  Biosynthesis of unsaturated fatty acids
tca01100  Metabolic pathways
tca01200  Carbon metabolism
tca01212  Fatty acid metabolism
Module
tca_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tca_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tca_M00085  Fatty acid biosynthesis, elongation, mitochondria
tca_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    662336
   00650 Butanoate metabolism
    662336
  Lipid metabolism
   00062 Fatty acid elongation
    662336
   00071 Fatty acid degradation
    662336
   01040 Biosynthesis of unsaturated fatty acids
    662336
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    662336
   00310 Lysine degradation
    662336
   00380 Tryptophan metabolism
    662336
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    662336
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     662336
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     662336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 662336
NCBI-ProteinID: XP_973530
Position
LG5
AA seq 761 aa AA seqDB search
MSTLRFFGALSKISRTNIKFKNTAQIRGMASQERKHTKLKVVDNIGVIVLDSPGVKVNSL
NGEVMGEFGSVLHEIESNPQIQAAVLISAKPNCFIAGADITMLEKCQSAEEATKISREGQ
EMLAAIESSNKPIVAAIQGSCLGGGLEVALSCHYRIAVKDKKTGLGLPEVMLGLLPGAGG
TQRLPRLSTVPNALDMSLTGKTLKADRAKKMGIVDLLVDPLGPGLGEPETVTRQYLESVA
VDVAKQLASGKLKVDRKKSQLTDRLLEFALQYNWVKDQIFGKAKAQVMKMSGGLYPAPLR
ILEVIRTGIDKGPKAGYEAEARAFGELAMTPQSKGLMGLFRGQTECKKNRFGKPSKEVKT
VAVLGAGLMGAGIAHVSVDKGYNVILKDTNPVGLARGLGQIQNGLQNAVKRKRLTGLERD
RFLSNLDATLDYKNFKKADIVIEAVFEDLNIKHKVVKEVEAIIPPECVFATNTSAIPISK
IAAASSRPDKVIGMHYFSPVDKMQLLEIITTDKTSKDTTALAVDVGLKQGKVVITVGDGP
GFYTTRILSAMMAESVRLLQEGVDPKELDSLTKKFGFPVGAATLADEVGLDVASHIGPDL
LKAFGERFGGGDMGVMRDIVQAGFLGRKSGKGIYVYEKGSKSRSVNHEALDIIKRYSVEP
KGAFEDEDKQLRMVSRFVNEAILCLEEKILANPLEGDIGAVFGLGFPPFTGGPFRWVDSF
GADRLVFKMEEFQKAYGLPFKPAQTLMDMAKDNSKKFYPRK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacactacggttttttggggccttatcgaaaatttcccgtactaacataaagttt
aagaacacagcacaaatccgcggcatggcctcacaggagaggaagcacacgaagctcaaa
gttgtggataatattggagtcatagtcttagactcgccaggagtcaaagtgaactctttg
aatggcgaagtaatgggcgagttcggctccgtcctgcacgagatcgagtccaacccccag
atccaagccgcagtattaatctccgccaaacccaactgtttcatcgcaggcgccgacatt
accatgttggaaaagtgtcaatcggccgaagaagccacaaaaatatcacgcgaaggtcaa
gaaatgctcgccgctatcgaaagtagcaacaaaccgatcgttgccgcaattcaaggctca
tgtcttggtggtgggctcgaagttgcactgtcctgccattacagaattgcagtcaaagac
aaaaaaaccgggctaggtttgccggaagttatgttggggcttctgccaggagctggaggc
actcagcgtttgccccgtctgagcaccgttccaaatgctttagatatgagcttgactgga
aagactttgaaggcggatcgagcgaaaaaaatgggaattgttgacttattggttgatcct
ttgggacctgggttgggtgaacccgaaactgtcacgagacagtatttggaatcggtggcg
gttgatgttgccaaacagttggccagtggaaaattgaaagttgataggaagaagtcccag
cttacagataggcttttggagtttgctttgcagtacaattgggtcaaggatcagattttt
ggaaaggccaaagcccaagttatgaaaatgtccggagggctgtatccagctccgcttagg
attttggaagttattcgaactgggattgacaagggccccaaggccggttacgaggccgaa
gctcgcgctttcggtgagcttgcaatgaccccgcagtctaaaggtttgatgggtttgttc
cgcggccaaaccgaatgcaagaaaaaccgtttcggaaaaccgtcaaaagaagttaaaact
gttgccgttttgggagctggtttgatgggtgccggcatagcccatgtctcagttgataaa
ggctataatgttattctgaaagacacaaatccggtgggtttggcacgtggacttggacaa
attcaaaatggtttgcaaaatgccgttaaaaggaagagacttactggactggagagggac
cgatttttgtcaaatctagacgcaactcttgactataaaaatttcaaaaaggctgatatt
gtaattgaggctgttttcgaagacctaaacattaaacataaagtcgtgaaagaggtcgaa
gcgattattcccccagaatgcgtttttgcaacaaacacaagcgctattccaatttccaaa
attgcggcagcttcgtccaggccagataaagttataggcatgcattatttttcacccgtc
gacaaaatgcagcttttggaaatcatcaccactgacaaaacgagcaaagacaccacagcc
ctggccgtggatgtaggtctaaagcaaggaaaagtggtgattacggtgggagacggccct
ggtttttacacaactcgcattttatccgccatgatggcagaatccgtaagactgctccag
gaaggtgtcgaccctaaagaactggattccttgacgaagaaattcggtttccctgtaggt
gccgccactttggccgacgaagtcggtttggacgtagcctcacacattggacccgacctt
cttaaagcttttggcgaaagattcggaggaggtgacatgggggtcatgcgggacatcgtc
caggccggtttcctaggccgcaagtctggcaaaggcatctacgtgtacgaaaagggaagc
aagagccgtagcgtgaaccacgaagctttggatataatcaagcgttattcggtcgagccg
aagggtgcgtttgaggatgaggataagcagttgaggatggtgtcgagattcgtgaatgag
gcgattttgtgcttggaggagaagattttggcgaatcctctcgagggagacattggtgca
gtattcgggttgggcttcccgccattcactggaggaccgttccgctgggtggactcgttc
ggtgctgataggttggtgtttaagatggaggagttccagaaagcctacggattgcccttc
aaaccggctcaaactttgatggatatggcgaaggataactccaagaagttctatccgcgc
aagtga

DBGET integrated database retrieval system