KEGG   Tribolium castaneum (red flour beetle): 662406Help
Entry
662406            CDS       T01046                                 

Definition
AGAP011688-PA-like
Orthology
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tca00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG5
AA seq 1569 aa AA seqDB search
MAPKKKRGGQNRVTFAPSKMSTRSGKKTATSPKTSKAKVPKMPKLATKATAKKGKAVPKA
KKAAPKKTKIEVTSTDSEPLEMESEIDSKNNDEDLQPEPIEQVFLKMDDNFMETTEPEGE
ETETCEIREQLESLNVEEAHEPKPGNEEVNEHSSEESVVEEVIEIDGCGEYEYITEEFVP
VVENAEVIIIDDEVEANNQVQEKPEQIISSEEKIQEMKLDETPQEEAKVDETKIVETPEQ
TKVEDKPAEETEIEDKLKEIEIETKLKKTVIEDKLEETKVEDKPEETKIDDKPEETKIDD
KPEETKEQPMETVTEEAPEPEPENKTVPEEVKKVEEPKKRPDAPKTKKKVPKPKEPKKNP
PKKKAAKPKPKKEPTDKTEEVRRSSRIKSINVLKQRSKGHGLVKSAKLPPDENKESATTQ
SSEEKSESATSLPATEADNKPVKVKSRWRRSSELEMNVLTPAAIVMETCGDSEKIAEANN
LENKTKPTHDEEVTTRLKQFVHLKENLYLTDRMSCKEAKKMTCDCFLTPEEIERGELGCG
EDCLNRLLMIECGGLCPVGDRCTNKKFQKSQFAPVEVFKTEKKGLGLRAAANIPYGEFIL
EYVGEVLDPEEFDNRADDYSNDKNKHYYFMSLRADAIIDATMKGNISRFINHSCDPNAET
QKWTVNGELRIGFFSTRTILAGEEITFDYRFQRYGKEAQKCYCESSLCRGWLGEEPDDED
DEDEEDEEEEEAEETKDKVEEDKPEAEKIDSEAKETKSVEKVQKPPVKEKKKRSPRKKPR
KELLEDLDQLDDEIDMLVTTGLKNQAHTLKLSRLMVRAKEPGQRAKLLRVLRRGELPCRR
LFLDYHGLRLMHGYMTDAQDLAKTDKKYESLRLEMLQTLATLPIPNKTMLQDSKVLPTVE
IWSSGKVNELPVDSDSSSPQTDQEPSQTPKEDDKKKEENVKEEEEVKDVKMDEDVEIRKS
RGMEFQGSSENVGFTNTHGKELADEISSIFQEEDNTSSPTPPETKIVKPEVKSDEPNYQE
EITALALKLLEEWSNLKEVFKIPKKERIEQMKEHEREANRGYIAGLGLEQDAEKKNESRY
RILKRYRSIDKVDNSARKNIKLEDRTIANFPKLGKYERRKMFALQVEQREEERRRKQREM
WRQHEQHCILLGTDPRLTAPFDPNRGYQCIWNPQIGQWQNYPIQNPNVIFNPQNPPVVSG
MNNPNYPYLHPPGMIPNNVNPLHALPSLPYQEEVTKEEDYSQVKFMGPIPPPVKLPPKWK
CAKDKYGRPYYYHIKIRKSQWEPPPFSQPQEEDLDDTSETSSSSDTSSLSSDTTSDESDS
DDDLDDSKLLMQVKRQMEKQVKIALPAPVKTEEDEASPVVEDKEEETKLETQVCEENSEE
TPQVEENNDEKAQPGAKKRRTGLVQEIIISPRTEEDRLQFKEDLKRYKLNKEKLKREKEM
IVQQTKKHAKEKRKSTIKLKMREMSDSNSETAKKVKEVFRSNMATVVVSVLNAYRKPDCK
EGRITNTDDFKHLARKLTHFVMLKEMKHIEKIDDLVCTENVKAKAKEYIRKYMSKFGENY
QKRNDEPDY
NT seq 4710 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaagaagaagcgtggggggcaaaaccgagtcacttttgcaccgagtaaaatg
tcaacaaggtctggtaaaaagaccgctacaagtccaaaaaccagcaaagcaaaagtgccg
aaaatgcccaaattggccacgaaggcgacagctaagaagggaaaagcggtccctaaagcc
aaaaaagctgcaccgaaaaaaaccaaaattgaggttacgtcaacagactctgagccactc
gaaatggagtcggaaattgatagcaaaaacaacgatgaggatttacaaccagaacccatc
gagcaggttttcctcaaaatggatgataatttcatggaaacgactgaaccagaaggtgaa
gaaactgagacttgtgaaattagagaacagctcgaaagtctcaatgtggaggaggcccac
gaacccaaaccagggaatgaggaggtgaatgagcatagtagtgaagaaagtgtggttgaa
gaagtaatagagattgatgggtgtggagaatatgagtacatcaccgaggaattcgtccca
gttgtggaaaacgccgaagtgataattatagacgatgaagtggaggcaaataatcaagtg
caagaaaagccggaacaaataataagttccgaggaaaaaattcaagaaatgaagcttgac
gaaacaccgcaagaagaggctaaagttgacgaaacaaaaattgtggagacacctgaacaa
acaaaagtagaggataaaccagccgaagaaacagagattgaagataaacttaaagaaatc
gagattgagaccaaactgaaaaaaaccgtgattgaggataaacttgaggaaacaaaggtt
gaggataaacctgaagaaaccaaaatagacgataagcctgaagaaaccaagatagacgat
aaacctgaagaaacgaaagaacaaccaatggaaactgtaacagaggaggcacctgaacct
gaacccgaaaataaaacagttccagaggaagttaagaaagttgaagagcccaaaaaacgc
cctgacgcccccaaaacgaagaagaaggtccctaagcccaaagaacccaagaagaaccct
ccaaaaaagaaagccgcgaagcccaaaccgaaaaaagaacccaccgataaaacagaagaa
gtgaggcgttcgagtcggatcaagtcaattaatgtcctaaagcagcgctcaaaaggccac
ggtttagtaaaatcagccaaactcccccctgacgaaaacaaagaatcagcaactacccag
tcaagtgaagaaaagtccgaatcggccacttcactcccagccaccgaagccgacaacaaa
ccagtcaaagtcaaatctcgatggaggagatcgagcgaattagaaatgaacgttcttaca
ccggctgcgattgtgatggagacttgcggagacagtgaaaaaattgcagaagccaataat
ttggaaaataaaacgaaaccaactcacgacgaagaagtcaccacgcgattgaaacagttt
gtacatttgaaggaaaatctctatttgactgatcgcatgagctgcaaggaggcgaagaaa
atgacctgtgattgcttcctgacgccggaggagattgaaaggggggaattgggctgtggg
gaagattgcttaaatcgcttactaatgatagaatgtgggggtttatgcccagttggagac
agatgtaccaataaaaaattccaaaaatcgcagtttgccccagttgaggtttttaaaacc
gagaagaagggactggggttgagagctgcagccaacattccttatggtgaatttattctg
gaatatgtcggcgaagtattggaccctgaagagtttgataaccgtgccgacgactattca
aacgataaaaacaaacattactacttcatgtcgttacgagccgatgcgataatagacgca
acaatgaaaggaaatatctcacgttttattaaccattcctgtgacccaaacgctgaaact
caaaaatggactgttaatggcgagttacgtatcggttttttcagcacacgtacgatctta
gcgggtgaagaaatcacctttgattaccgatttcaacgttatggaaaagaggcgcaaaag
tgttactgcgagtcgtcgctttgtcgcggttggctgggtgaagaaccggacgatgaagac
gacgaagacgaggaggacgaagaagaggaagaagctgaggaaactaaagacaaagtcgag
gaagataaaccagaagctgagaaaatcgacagtgaagcaaaagaaaccaagagtgttgaa
aaagtgcaaaaacctccagtgaaagagaagaagaagagatcgccacggaagaaaccgaga
aaagaattgttggaggacctagatcaactggacgacgaaatagacatgttggtgaccaca
gggttgaagaatcaagctcacactttaaaactgagcagattgatggtcagagccaaggag
cccggccaacgggcgaagctattgagagtcttaagaaggggcgaattaccatgcagacga
cttttcttggactatcatgggttgagactcatgcatggctacatgaccgacgcccaagac
ctggcaaagactgacaaaaaatacgaatcactcagattggagatgttacaaacgttagca
acgctgccaatccccaacaaaacgatgctgcaagacagtaaagtgttaccaactgttgaa
atatggtcctctggtaaagttaacgagttgccggtggattctgatagttcttcgcctcaa
accgatcaggagccaagtcaaacacccaaagaagatgataagaaaaaagaggaaaatgtg
aaggaggaagaagaagtgaaagatgttaaaatggatgaggatgtggaaatacgcaagtcc
agaggaatggaattccagggtagctcggaaaatgtgggttttacgaacacacatgggaag
gaattagccgacgaaatttcgagcattttccaagaagaagacaatacttcgtcacccaca
ccaccggagaccaaaatcgtgaaacccgaggtgaaatctgacgagcctaattaccaggag
gagatcacagctttggccttaaaactgttggaagagtggtccaacttgaaggaagtcttc
aaaattcccaaaaaagaacgaatcgaacaaatgaaagagcacgaacgtgaggccaaccgt
ggctacatcgccggtttggggttggaacaagacgccgaaaagaaaaacgaaagtcgctat
cggattttaaaacggtacagatccattgataaagtcgataacagcgcgcgaaaaaacatc
aaactggaagaccggacgatagccaacttccccaaattgggcaaatacgagcggaggaaa
atgtttgcgttgcaagtggagcaaagggaggaggagaggcggcgaaaacagagggagatg
tggaggcagcatgagcaacactgtattctcctcgggacggatccccgcctgacagcccca
tttgaccccaacagggggtaccagtgcatatggaacccccaaatcgggcaatggcaaaac
taccccatccaaaatcccaatgttattttcaacccccaaaatccacccgttgtctcaggg
atgaacaacccgaattatccctacttgcaccctccgggaatgatcccgaacaacgtgaac
ccgctgcacgcactacccagtcttccataccaggaggaagtgaccaaagaggaggactac
tcacaagttaagttcatgggacccattccgcccccagtcaaactaccaccgaaatggaaa
tgtgccaaagacaagtacggacggccttattattaccacatcaagatcaggaaaagtcag
tgggaaccgccaccgttttcgcaaccacaggaggaagacttggatgacacgagcgaaacg
tcttcaagctctgacacgagtagcttgagctcggacacgacctcggacgagtcagacagt
gacgatgatttggacgactccaaactgttgatgcaggtgaaaagacagatggaaaaacaa
gtaaaaattgcattacccgcccctgttaaaaccgaagaagatgaagctagtcccgtggtc
gaggacaaggaagaagagactaaacttgaaactcaagtttgtgaggaaaatagcgaagaa
acacctcaggttgaggaaaacaatgacgagaaagcgcaaccaggggctaagaagcgacga
actggactggtccaggaaattatcattagtccgaggactgaagaggaccgattgcaattc
aaggaagacttgaagcgttacaaactaaataaagaaaagttgaagcgggagaaggaaatg
atcgtccagcaaacaaaaaaacacgcgaaggagaagcgcaaaagtactattaaattgaaa
atgagggaaatgagtgattccaacagcgaaactgccaagaaagttaaggaggttttccgt
tcgaatatggcgactgttgtcgtcagtgttcttaacgcgtatagaaagccggattgtaaa
gaagggagaattacgaatacagatgattttaagcatttagctagaaaattgactcacttt
gttatgttgaaagaaatgaaacatattgagaagattgatgatttagtctgcactgaaaac
gtgaaagcgaaagctaaggaatacatccgcaaatatatgagtaagttcggagaaaattat
cagaagcgaaatgatgagcccgattattaa

DBGET integrated database retrieval system