KEGG   Tribolium castaneum (red flour beetle): 662523Help
Entry
662523            CDS       T01046                                 

Definition
(RefSeq) cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B
  KO
K11269  
chromosome transmission fidelity protein 18
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Chromosome [BR:tca03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    662523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG8
AA seq 843 aa AA seqDB search
MDEFPNSDDEFELMYGDDLEVLHEQGDVQRTPRKSRRSLEFTQTPVSHNDNSFSDAFTPL
EAPVPELNTNKRSIEELFGDIDDILYENRANAKRYKGDNADELALIEHIVELRKLNRERD
APEIFRKAHVQSIDRAKDNLSYTVPSYPFVGVTRVDGRRLYIRCHSEQYELEERQKIVQE
INLACTLGPNDGLWAEAQDLILKQATAPDLEQCYQPGDKELWVDLYKPRKYFELLSDEST
NRIMLRWLKLWDKAVFKRRPKIKPIKPAEKNKKMFKAPDLCTDLDEHGRPLHKIALLCGP
PGLGKTTLAHMVARHAGYNVVEVNASDDRSCEAFKTALENATQMRSVVDQERRPNCLVFD
EIDGAPPSSIDYLVKFVQGGPSGRKKQKERNVLKRPIICICNDVYVPALRPLRQIAFVVN
FPPTSNTRLAERLMEIAKWQKVKTDMGAMLALAEKSQNDIRACLSVLHFFKSQDKAVTLS
DVHKTSVGQKDIQKGIFSVWRDIFLIDKANGDSLKARMSGVLNVVNAFGDYEKIAQGVFE
NYPNLKFKNTSMVETCLALDWFGFSDIVNKSIYSTQNYNLGSYLPFACVVWHFAFGSRSW
QKLQYPSAGYEARTKQNRQKAIVNELMRGMQPAIRSHVQPNSLILDILPLLTTIITPAFR
QISLHLYTEEEKKSLDNVVRIMVDYNLSYVQERTADGGYDYKLDPNIDELVSFGPKKSLS
YSNKQLIAKEIETAKMRRFEPVQPERSAAPMPNHLQTLKAKSVCGVEMPAVVRDFFGRVV
TKASSSSGKPQTRNDVWFKYKEGYSNAVRKPIKISTLKRLQALPLPAPSTISSRVPPAMC
FHL
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggacgagttccccaattctgacgatgagttcgagcttatgtacggcgacgatctcgag
gtgctccatgagcagggagacgtccaaaggactccaagaaaatcgcgccgaagtcttgaa
ttcacccaaaccccagtctcccacaacgataactccttcagtgatgctttcacccccctt
gaagcccccgttcccgagcttaacacaaataagcgttcaattgaggagttgtttggcgac
attgacgatattttgtacgaaaatcgggcgaatgcgaagcgatacaaaggtgataatgcg
gacgagctagcgctaattgagcacatagtcgagctgcgtaaactaaaccgggagcgtgac
gccccggaaattttccggaaagcccacgttcagagcatagacagggccaaagacaacctg
tcgtacaccgtcccgagttaccccttcgtgggggtgacgcgggtcgacggccgccggttg
tacatccggtgccactccgaacagtacgaactggaggagcggcaaaaaatcgtccaagaa
atcaacctcgcgtgcactttggggcccaatgacggcctctgggccgaggcccaagacctg
attttgaaacaggccacagcccccgacctggagcagtgctaccaacccggcgataaagaa
ctatgggttgacttgtacaaaccgcgcaaatatttcgaacttttgagcgacgaaagcacc
aaccggataatgctgcgttggctgaagctttgggacaaggccgttttcaagcggcgcccc
aaaatcaagccaatcaaaccggcggaaaaaaataaaaaaatgtttaaagcccccgatctt
tgcacggatttggacgaacacgggcgtccgctccacaaaatcgcgctactgtgtgggccc
ccagggctcgggaagaccactctggcccacatggtggcaaggcatgcgggctataacgtg
gtggaggtgaatgcgtccgatgatcgcagttgcgaggcttttaagacagctctggagaac
gcgacgcaaatgcgctcggttgtggatcaggagaggcgccccaattgtctcgtttttgac
gagatcgacggggcgcccccttcctctattgactatctcgtcaagttcgtgcaagggggc
cccagcggcaggaagaaacagaaggagaggaatgtcttgaaacggccgattatctgcatt
tgtaacgatgtttacgtgccggcgctgcgccccttgagacaaatcgcgttcgttgtcaat
tttccgcccacttctaacacgagacttgccgaacggttgatggaaattgcaaagtggcaa
aaggtcaagactgacatgggggccatgctagccttggccgagaagtcccaaaatgatatt
cgggcttgtttgtctgtcctacacttttttaagtcgcaagacaaggctgtgacgttatca
gatgtgcacaagacaagcgtcggacaaaaagacattcaaaaggggattttttcggtttgg
cgggatattttcctaattgataaagcgaacggagacagtttgaaggcccgaatgtcgggg
gttttgaacgtagttaacgccttcggtgactacgaaaaaatcgcccaaggcgtgtttgaa
aattacccgaatttgaaattcaaaaatacatccatggttgaaacctgcctggccttggat
tggttcggcttttccgatattgtaaacaagtcaatttattcgacccaaaactacaatttg
gggagctatttgccgttcgcttgtgtcgtttggcactttgctttcgggagccggagctgg
cagaagttgcagtacccgagcgcgggatacgaggccagaaccaagcagaacagacagaaa
gcgatcgtcaatgaattgatgcgtggaatgcaaccggcgatacgatcccacgtccaacca
aattccctaatccttgacattttacccctgctcacaacaatcatcacgccggcgtttaga
caaatcagcctgcatttgtacaccgaagaagagaaaaagagcttagataacgtggtcagg
attatggtcgattacaacctcagctatgtgcaggagaggactgcggacgggggatatgac
tacaagttggaccctaacatcgacgagctggtgtccttcggccccaaaaaatccctctcc
tactccaacaagcagctcatcgctaaagagatcgaaactgcgaaaatgcgccgtttcgaa
cccgtccagcctgagcgttccgccgcccccatgcccaaccacctccagacgctgaaggcg
aagtccgtgtgcggcgtggaaatgccggcggtggtgagggactttttcggccgcgtggta
acgaaggcttcatcgtcatcaggaaaaccgcagacgaggaacgacgtctggttcaagtac
aaggagggctacagcaacgccgtccggaaaccaataaaaatatccactctcaagagactc
caagccctcccgctccctgctccttccaccatttcgagccgtgtcccgcccgcaatgtgc
ttccatctctag

DBGET integrated database retrieval system