KEGG   Tribolium castaneum (red flour beetle): 662523Help
Entry
662523            CDS       T01046                                 

Definition
cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Module
cGMP signaling
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     662523
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   662523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 804 aa AA seqDB search
MKIKHYPGKAVINDPAWLEMDISNDIRGRQYEANWEDTQRNLSSTNSSGSNSWDKYSEGT
ISSKLGHYQKVLDDLAQEELYTQPIKKEEKPKYHSEKCLARINNNTVPNYYLPSQAKIQK
SRSFKETEDKPKPKPRTKLAQNLKNVVNDLEKQIKSVRFTEEEEAEPGQRISQWIDDQNK
YILTDSVLIKGEDLPKKPRQRIPPRNLTPSPSEVSDERSSAYNLYKSGAKAQVLEAQNSD
FLIPRPKLIVPVHTYAVRRRRTGNLQCAGEEVIKNKDSEGCVEVSRENKFLSTLTPGKVL
GELAILYNCQRTATIKAATDCKLWAIERQCFQTIMMRTGLIRQAEYTDFLKSVPIFKNLP
EDTLIKISDVLEETFYANGDYIIRQGARGDTFFIISKGTVKVTKKVPDSNEEKYIRTLGK
GDFFGEKALQGDDLRTANIIVDNPEGVYCLVIDRETFNQLISNLDEIRTKYKDEGVDRRR
ENEEFEHVQLTDLKKLTTLGVGGFGRVELVQIQGDSNRSFALKQMKKAQIVETRQQQHIM
SEKEIMGEANCDFIVKLFKTFKDRKYLYMLMESCLGGELWTVLRDKGHFDDATTRFYTAC
VVEAFDYLHSRNIIYRDLKPENLLLDNQGYVKLVDFGFAKKLHSGRKTWTFCGTPEYVAP
EVILNKGHDISADYWSLGVLMFELLTGTPPFTGADPMKTYNIILKGIDAIDFPRNITRNA
MALIKKLCRDNPAERLGYQKGGISEIQKHKWFDGFNWEGLVNRTLTPPILPQVKHVTDTS
NFDDYPPDTDTPPPDDVSGWDADF
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaaacattacccgggcaaggcggtgatcaacgatcccgcttggctagaaatg
gacatttcgaacgacatcaggggacgccagtatgaggcaaactgggaagacacccagcgg
aatttatcgtcaactaacagttctgggtccaattcttgggacaagtacagcgaaggaacg
atttcctcaaaactggggcattaccagaaggtgctagatgacctagcacaggaggaactg
tacacacaacccatcaaaaaagaggagaagcccaaatatcacagcgagaagtgtttagcg
aggattaacaataacacagtcccgaattattacctgccttcgcaagccaagattcagaag
agtcgcagttttaaagaaacggaagataaaccaaaacctaaacctagaactaaactggcc
cagaatctcaaaaacgtggttaacgatctagagaagcaaatcaagtcggttcggtttacc
gaagaagaggaggccgagcctgggcaaagaatcagccaatggattgatgaccagaacaag
tacattttaactgacagcgtgctgatcaagggcgaggacctgcccaagaagccgcgccag
aggatacctccaaggaacctcacgccgtcgccgtcggaagtcagtgacgagcgttctagt
gcgtacaatttgtacaaaagtggcgcaaaagcgcaagtgctcgaagcgcaaaacagtgat
tttctgattccgcgtccgaaactgatcgtccctgtgcatacgtacgcggtgaggaggcgg
cgcaccggcaacttgcagtgtgccggcgaagaggtcatcaagaacaaagattcggagggt
tgcgtcgaagtctcccgtgaaaacaagttcctgagcaccctcacccctggcaaggttcta
ggcgagctcgcaatcctctacaattgtcaaaggaccgcaactatcaaagccgccaccgac
tgcaaactatgggccatcgaacggcaatgcttccagacgattatgatgaggaccggcctc
atcagacaagccgaatacaccgatttcctcaagagcgtccccatcttcaaaaacctcccc
gaagacactctcatcaaaatatcggacgttctggaggaaaccttctacgccaacggcgac
tacatcatcagacagggtgccagaggcgacaccttcttcatcatcagcaagggcacggtc
aaggtgacgaaaaaagtgcccgacagcaacgaagaaaagtacatcaggacgctgggaaag
ggcgacttcttcggcgaaaaagccctccaaggggatgatctgcgcacggcgaacatcatc
gtcgacaaccccgaaggggtctattgtctggtcattgaccgcgagacgttcaaccaactg
atctcgaacctggacgagatcaggaccaagtacaaggacgagggagtggacaggagaagg
gaaaacgaagagttcgaacacgtccaactgaccgatttgaaaaaactcacgactttgggc
gttggcgggttcggacgcgtcgaactcgtgcaaatccaaggcgactcgaaccgctcgttc
gccctcaagcagatgaagaaggcacagatcgtggagacgcgtcaacagcaacatatcatg
tccgagaaggagattatgggcgaggctaattgcgactttatcgtcaagctgttcaagacg
tttaaagaccgcaaatatttgtacatgctgatggagagctgtctgggaggcgagctctgg
acggtgttgagggataagggacactttgacgatgccacgaccaggttctacaccgcctgc
gtggtggaggcgttcgattatctgcattcccgcaacattatttacagggacttgaaaccg
gaaaacctcctcttagacaaccaaggctacgtgaaacttgtcgatttcgggttcgccaag
aagctgcacagcggccgcaagacctggacgttctgtggaacccccgaatacgtggcccct
gaagtgatactgaacaaggggcacgacataagcgccgactattggtcccttggcgtgctg
atgtttgaactgttgacggggacgccgcccttcacgggagcggaccccatgaagacctac
aacatcatcctgaaaggcatagacgcgatagatttccctcggaacatcacgcgcaacgcc
atggcccttatcaagaaactgtgcagagacaacccggccgagcgcttggggtaccagaaa
ggggggattagcgagatacagaagcacaagtggttcgatggtttcaactgggagggtctg
gtgaacaggacgctgacgccgccgattttgccgcaagtcaagcacgtgacggacacgagc
aacttcgatgactaccccccggacacggacaccccgccacctgatgacgtgtcgggctgg
gatgccgatttttag

DBGET integrated database retrieval system