KEGG   Tribolium castaneum (red flour beetle): 662526Help
Entry
662526            CDS       T01046                                 

Definition
similar to CG9485-PA, isoform A
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    662526
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     662526
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     662526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG9
AA seq 1766 aa AA seqDB search
MFQSWKTAQCNNENVFLPLETLYGNPSLNLVFPEQKSGYYVSFNKIRVIVVCFNIAKLVT
ISGGRGEANDQDQNKEKSKKKAKPKPKKSPLREPSFSTTLTDPIEEVIEEILDEEVKSPK
PRKRNKKSKPKSSDDEVGFSFFKSKSSESLPKFEENSTAKLSPEAVSDPPEDSLGFSFLP
VRDKKQKKNQKVKIDDLPKSTLIEHFKHNKRAKNEFVVIEKVEVEDKPENCIEIVNKETG
KKVYLEAKESKKVHSKISYASVASQRFEESLEQLRREEESKADSGVNGGSKRQVEEELAT
QIQGEERRLVDLLDQDHKPGGEIPEDSSFVEFNGGLVEEITAPIEETKTDPGEEILERAE
EPKTAPGEEIVELIQSIVDTVNSETASSELLSEEISPFKMSSGTQVRVLTLNDKEHQDST
LYRLQKNWILQFRLGPSLLGRKVSLYCNYPQTGDFKRHSYALLKWQQDEGCQHSDDTALL
TELTLEKSGSFHYFFTYDDQIEHQGSGFFHVDPVLKYGKNEKLPLDCIQCQTVLAKGLGP
FDTWENKLQVAKESGYNMVHFTPIQELGASNSSYSLSEQLKINPLFTKQNGSETTFEDVS
DLIKKMRQEWKVVSICDIVLNHTANESAWLKEHPEATYNCQNCPYLRPAYLLDAAFHQFS
LDVSKGVYEDKGIPPQVSTEDHLHSIRYHLHNDVLSQLKIPELFICDVAKNTADFLNLIR
NKIPTQIESKIEGELKLIQDPQFRRLASSIDMDLATKLYNNYRLDCYDEETRIKKCAEDF
KNKLEALNKAMIDEVNEHLKVAVENVIAGIRYFRVQPDGPKVREISLKNPLVFRYFTDYG
TPKSIKEHEAIMNSENGRFLMAHNGWVMNSDPLRNFAAPDSNVYIRRELIAWGDSVKLRY
GEKPEDSPFLWGHMREYVELTARIFDGVRLDNCHSTPIPVAEYLLDCARKINPDLYVVAE
LFTNSDLTDNIFVNRLGISSLIREAMSAWDSHEQGRLVYRYGGSPVGSFYQPRIRPLVPS
IAHALFLDLTHDNPSPVEKRSVFDLLPSTALVNMACCASGSNRGYDELVPHHVHVVDETR
QYTEWTQNESLATGNARYITKKSGIIAAKQALNELHFHLGAQGFDQVYVDQMDPDVVAVT
RHCPETHESYVLVAFTAFTHPPEGAEGHQRAIKPLRVEGVLDEIVLEATLNQTNPKCGSK
YTKSQNHRKDNKWINGLSEYQVHLNQHIQASESETVEKVDSGSPNVVQLNFKNFKPGSVL
VIKVSLPEDMREAIKNVRSLISQFSFKKGTELWKIISEMSLADLNRALYRCDQEERDEGH
GFDTYEIPNFGRLVYAGFQGFMSLLSTIRPNNDLGHPMCANLRDGNWMIDYIWQRLKLDD
GTKRLGQWFEENSKSLKSIPRYLVPCYFDVIVTGIYVLLFEQCYALMSDFVKLGSAFVKG
LAMGSVQMAAYIKSADLPQLSPNLSAPKPPQRKNNKGELVQSCVTMSAGLPHFSVGYMRN
WGRDTFIALRGLFLLTGRFEDARYHILGYAACLRHGLIPNLLDGGRNSRFNCRDAVWWWL
HCIKCYTEDAPSGLSILQNKVSRIFPTDDSPPQPPGQFEQPLHAIMQEALNVHFQGLVFR
ERNAGRQIDEHMTDQGFNNQIGIHPXXXXXXXXXXXNDSDNFNVAHGMNYHQGPEWVWPV
GFYLRARLRFAAANNQLARTVADTKVVLAKHFVELQTSTWRGLPELTNKNGAFCKDSSRT
QAWSMSCILEVLYDLQRIERDQLTIN
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagtcatggaaaaccgctcagtgtaacaatgaaaatgttttcctgcctttggaa
actttatatgggaatccttcacttaatcttgtttttcctgagcaaaagtctggctattac
gtttcatttaataagatacgggttattgtggtgtgttttaatattgctaagcttgtcacg
atatccggcggtcgaggcgaagcaaacgaccaagaccaaaataaggaaaaatcgaagaag
aaagcgaaacccaaaccgaagaaaagtccactacgggagccctccttcagcacaacactc
acagacccgattgaggaggtcatagaggagatattggacgaagaagtgaagtcacccaaa
ccgagaaaacgaaataagaaaagcaagccgaaaagtagcgacgacgaagtcggtttctcg
tttttcaaaagcaagtcgtcggaaagtttgccaaaatttgaggaaaattctacagctaag
ttgagtcccgaggccgtgtcagatccaccagaggactcactcgggttttcctttctcccc
gtcagggataagaaacagaagaaaaatcagaaagtgaaaatcgacgatttgcccaaatcg
acgctcattgagcatttcaagcacaacaaaagggccaagaatgagtttgttgtgattgaa
aaggttgaagttgaagataagcctgaaaattgtatcgaaatcgtcaataaagaaaccggg
aaaaaggtttatcttgaggccaaagagagcaaaaaagtacactcgaagatatcgtacgcc
agcgtcgcttctcagcgttttgaggaaagcttggaacagttgaggagggaggaggaaagt
aaagctgattctggagttaacggtggttcaaaacgccaagttgaggaagagttagcgact
caaattcagggtgaggaacgcagactggtcgatttacttgaccaagaccacaagcccggt
ggagaaatacccgaagattcttcgtttgtggagtttaatgggggtcttgtcgaagaaata
actgcacctattgaagaaactaaaaccgaccctggtgaagaaatactagaacgagccgaa
gaaccaaaaacagcccctggtgaagaaatagtagaactgatacaaagcattgttgacact
gtcaatagtgaaacagcgtcttccgaacttttgtctgaagaaatttctcccttcaaaatg
tcttccggtacccaagtgcgcgttctgaccctaaacgataaagaacaccaagactcgact
ctttaccgcctgcagaaaaactggattcttcagttccgtctcggcccttccttactcggg
cggaaagtgtcgctttactgcaactaccctcaaaccggcgacttcaagcgacactcctac
gccttgctcaagtggcaacaagacgaaggttgccagcattccgacgatacggcccttctg
actgaattaacactcgaaaagtccggaagttttcactactttttcacctacgacgaccag
atcgaacatcaaggctccggttttttccacgtagacccggttttgaaatacgggaaaaac
gaaaaattgccgctggattgtattcagtgtcagactgtgctggctaagggcttgggcccg
tttgacacgtgggaaaataaactacaagttgccaaagaatcgggctataacatggtccac
tttacgccaattcaggaattaggagcttcgaattcgtcgtacagtcttagcgagcagttg
aagatcaacccattgttcacgaaacaaaacggcagtgaaacaacgtttgaggacgtcagt
gacttgattaagaaaatgcgccaggaatggaaggtggtttcaatttgcgatattgtcttg
aaccacacggccaacgaaagtgcctggcttaaggagcacccggaggccacctacaactgt
caaaactgcccctatttgcggcctgcctacctgctagatgccgcctttcaccagttttcc
ttggacgtgtctaagggggtgtacgaggacaaagggattccgccccaagtctcaacagag
gatcacttgcactccatccgttaccacctccacaacgacgttttatcccagttgaaaatc
cccgaactgttcatttgtgatgttgctaaaaacaccgcagactttctgaatttaattcgt
aataaaataccaactcaaatcgaatcaaaaattgaaggcgaactcaaactgatccaagac
ccgcagtttcgacgacttgcctcaagcattgacatggatttagccacgaagttgtacaat
aattaccgtctcgattgttacgatgaagagactaggattaaaaagtgcgctgaggatttt
aagaacaaactcgaagcgcttaacaaagcgatgattgatgaagttaacgagcatttgaag
gttgcagttgagaatgtaattgccgggattaggtacttcagggtgcaacccgacggcccc
aaagtccgcgaaatttccctgaaaaacccgctagtttttcgctatttcaccgattatggg
actcccaagagtatcaaagagcacgaggcgattatgaatagtgaaaatgggcggtttttg
atggctcataacggttgggtcatgaattcggacccgttgaggaatttcgcagcccccgat
tcaaatgtttatatcagacgggagttgatcgcatggggggatagtgttaaattgaggtat
ggggagaagccggaggattcgccgtttttgtggggacatatgagggagtatgtggagttg
acggcgaggatttttgatggggttcggttggataattgccattcgacgccgattccggtg
gcagaatacctccttgactgcgcccgaaaaatcaaccccgacctgtacgttgttgccgaa
ctgttcacaaactcggacctaaccgacaacattttcgtcaaccgcctcggcatatcatcc
ctgattcgagaagccatgtcggcttgggattcccacgaacaaggccgtctcgtctaccgc
tacggtggttccccggttggttcattctaccaaccgcgaatccgcccccttgtgccctca
atcgcccacgccctcttcctcgacttaacccacgacaaccccagtccggttgaaaaacgc
tccgttttcgatttattaccaagcacagccctcgtcaacatggcatgctgtgccagcggc
tcgaaccggggctacgacgagctggtcccccaccatgtacacgtggttgacgaaacgcga
caatatacagagtggacacaaaacgagagtcttgccaccggaaacgcccggtatattacg
aaaaaatcggggattattgcggccaagcaagcgctaaacgagctgcatttccacttgggg
gcccaaggatttgatcaagtttatgtcgaccaaatggacccggatgtggttgcagtcacg
aggcattgcccggagacacacgaaagttacgttctggtcgcctttacggctttcactcat
ccgccagagggcgctgaggggcaccaaagagccatcaaaccgctcagagtcgaaggagtc
ttggacgaaattgtcctggaagcgactctcaatcaaaccaatcccaagtgtggttcaaaa
tacacgaaaagtcaaaatcatcgcaaagataacaagtggattaacggcttgtcggaatat
caggtccacctgaaccaacatattcaagcaagtgagtctgagactgtcgaaaaggtcgat
tcaggatcacccaatgttgtccaattgaattttaaaaatttcaagccggggagtgtcctc
gtaatcaaagtgtcgttacctgaggatatgagagaggcgattaaaaatgtgcgcagcttg
atcagccaattctcttttaaaaaagggacagaactgtggaaaataataagcgaaatgagc
ttagccgacttgaatcgggccttgtacaggtgtgaccaagaggagagggacgaaggccac
ggtttcgacacttacgaaattccgaatttcggtcgcttggtctatgccggctttcaaggt
tttatgtctttgttgagcactattcggcctaataacgacctgggtcaccccatgtgtgcc
aatttgcgcgacggaaattggatgattgattacatctggcagagattgaagctcgatgac
ggcaccaagcgcttggggcagtggtttgaggagaactcgaagtcgctcaaatccataccg
cgctacttggtcccgtgctacttcgacgtgattgtcacagggatctatgttttgctgttc
gagcagtgctacgcccttatgtcggattttgtcaagctcggctccgcctttgtcaaaggt
ctagcgatgggttcggtccaaatggcggcttacataaagtccgctgatttgccgcaactt
tcgccgaatctttcggcacctaagccgccccaaaggaaaaataacaagggcgagttggtg
cagtcttgtgttacgatgtcggccggcttgccccatttctcggtggggtatatgcgtaac
tggggtcgggacaccttcatagccctgagagggctatttttgctgactgggcggtttgag
gatgctaggtaccacattttggggtatgcggcctgcttgagacatgggcttatacccaat
ttgctcgacggtggacgaaactcacgcttcaactgccgcgacgccgtctggtggtggctg
cactgcatcaaatgctacaccgaggacgccccctccgggctctccatcctccaaaacaaa
gtctcccgcatcttccccaccgacgactcgccccctcagccccccggccaattcgagcag
cccctccatgccataatgcaggaagccctcaacgtccacttccaaggcctcgttttccgc
gaacgcaacgccggccgccaaatcgacgaacacatgaccgaccaaggcttcaacaaccaa
atcggaattcatccnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnaacgattcggat
aatttcaatgttgcccatgggatgaactaccatcaaggcccggagtgggtgtggcctgtc
ggcttctacctacgtgccaggttgcgattcgctgccgctaacaaccaattggcgagaacc
gtggccgacactaaggtcgttttagcgaaacatttcgtcgaattgcaaacgtctacgtgg
cgcggtctccccgaattgaccaataagaacggagcgttctgcaaagacagctcaaggacg
caagcgtggagcatgtcgtgcattttggaagttttgtacgacctccaaaggatcgagagg
gaccaactgacgatcaattga

DBGET integrated database retrieval system