KEGG   Tribolium castaneum (red flour beetle): 662527Help
Entry
662527            CDS       T01046                                 

Definition
histone-lysine N-methyltransferase NSD2
Orthology
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    662527
Enzymes [BR:tca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     662527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 1740 aa AA seqDB search
MASPQACLSSSPEIVSPGGKSRYGRTRRPKISHDFCNIDDVIIDDNPPEVKSPLKARDVV
FEIKDEFTKLDDLGMKVANNFKTNRGLDASIKERKFFKSAVVSKAVDVVDVSKVLKLVST
PGAEAQAKSPPKTVLKTYSNRRKHAENERVVESFGLPDEPIIPVKGHAFQRHSKIDVDFA
AENDVSLPNPWTFDEIFTNEMKGPTNGETFDENTDFQQTLTPKGAKNAFERTTGKKRLFR
SSAEEGGTIVTVSPVLKKAKVGSSPPKRVLRSNFESNVKIQSSVSPQNETNDSVVEAELP
SAGNESEEELPNISHKSLRSSTLKNKSPEKRIEISHEKNKIKTKSPEKCKPKKGLNLVKT
AKEISTETNKIRVGGTECTVKNKSPKKSKTKEALNPVVTVEEISPEKNNVQDDAAEENPL
KNGSSGKSKTKEALNPVKMVKTSAEKNDGLEAVTKSALTMTQTKTKEVFNPVVIVTEISP
EKNNVQEDVAENRTEESGPKNKPKEVFLNPVIIMKEFSAVKNDGPEAAESEPSMTQSKTK
EVLEISAETNQVPENETKEELKVIKQEVIELEVGVLAWAKLGNFPYWPCLITQEPASGTH
QKYVVNRIHPLYHVRFFGDKGRRSWVHGPNVMPFYAKDDLERLAKTLEVEGKFKPSYINE
CCFIRRTLMKKWQEGVAEAESLQFKTVDERLNYFSKMFARKNELKQERQKLKRARLSAAE
NLSKKVKIEEIETLELIKPEPVEVTSSPDTLIKPPKKKNFLKKEEFSDEQLEARKKLRNP
QVREEIPQPSSAPKLRKKPQGENSNSDTDSKFSDNSSLPPSMQSQAALFRRNNIFRGIPR
EKVCQICEKSGEIFKCKGPCNGVYHPECAMNRVVEQKSSVEIISLESKQPLPDLGTSPNY
TGMSLAEKIDHRMKEIMKKFDQSVYCESTDSSSDEYVVEEVVRQASPPAQSKLSLTVTAT
PTKKEVPIIKHVTADNISYICVSNEAPKEDTTGLKCTWCASDEAPLCLVCGEMGAQGRQK
CSLHQCGRFYHPECLKLWPQTQWSLNASDSFVCPRHVCHTCISDDPRAANSRCSSDKIVK
CLKCPATYHSSNYCVPAGTEILTASQIICPRHFTRNKRNYQSTINANWCFICSNGGDLIC
CETCPTSVHRECLPGDLGEVETFFCEDCQSGRLPLYDEIVWVKLGSFRWWPAVILFPNEV
PDNVKNIPHSKGEFVVKFYGTYDHYWVGRGRTFLFQEGDRGHSGSVKKRVDNAFVKAIEE
AAAAHELKKQFKARKFEEKNSGMKPPPYVRIKVNKPVGNVRVFDGNTSNTTSCDCDPNQP
HPCGPDSDCLNRLLLTECNPDVCPAGDRCNNQCFEKREYPPLVPHRTLYRGWGLKTLAPI
RKGQFVIEYVGEMIDEQEYQRRVQKMHEQKEENYYFLTIDKDRMLDAGPKGNVARFMNHS
CDPNCETQKWTVNGDTRVGLFANCDIPAGTELTFNYNLECIGKEKKICHCGAPNCSGFIG
VKVKTDNPPKKSTKAKKKKTPPLEYVDNDNPCFICGKQGDVAACNNKICTKYYHLACVGL
EAWPEGNKWVCQWHNCNICTKRTIRCCVRCINSYCPSHSDGNVRYDKLLGFVCSEHDSSK
ESNAVVTSHVPAPDSCVSDEGVVTSTTSDDSRMNGFVTSTPVKKNDNSYDESVVSSSEKK
PKKVKKKKVENTANFLLENEVKLNNFAPVKYLRTSRSRNSDPERDLPIRKRTRLRCGSSL
NT seq 5223 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcctcaagcctgcctgagttctagtcccgaaatagtcagccccggaggcaag
tcccgctatgggcggaccaggcgccccaaaatctcgcacgacttttgcaacatcgacgac
gttatcatcgacgataaccccccggaagtgaagtcgcccctcaaggcccgcgatgtcgtg
ttcgagatcaaggacgagtttacgaaactcgacgacttggggatgaaagtggcgaacaac
ttcaaaacgaaccgaggcttggatgcttcgatcaaagagcgcaagtttttcaaaagtgcg
gttgtaagcaaggcggtggatgttgttgacgtgagcaaggtgcttaagttggtttcgacg
cccggtgccgaggcccaggccaaaagcccgccgaaaaccgtcctgaagacgtactcaaat
cggcggaaacacgccgagaacgagcgcgttgttgagagttttggtttgccggacgaaccg
atcattccagtgaaaggccacgctttccagcgacatagcaaaattgatgtcgattttgcg
gccgaaaacgacgtgagtttgccgaatccgtggacgtttgatgagatttttaccaacgag
atgaagggacccacgaatggagaaacctttgatgaaaacaccgattttcaacaaacgctc
acccccaagggggccaaaaacgccttcgaacgtactacaggaaagaagaggttgttccgc
agttctgcagaggaagggggcacaatagttacagtttcaccagtgttaaagaaagccaaa
gttgggagtagccccccgaagagggttctcaggtcgaattttgagtcaaatgtgaaaatc
cagtcgtctgtttcaccacaaaatgaaacaaatgatagtgtagtggaggcagagttgcca
agtgcgggcaatgaatcagaagaggagttgccaaatataagtcacaagtcactaagatca
agcactctaaaaaacaagtcacccgagaaaagaatagaaatttcccacgaaaaaaataaa
ataaaaaccaagtcacctgaaaaatgtaagccaaaaaaaggcttaaatctggtaaaaaca
gcaaaagaaatttccaccgaaacaaataaaatacgggttggtgggacggagtgtactgta
aaaaacaagtcgcctaaaaaaagtaaaacaaaagaagccttaaatcccgtagtaacagtc
gaagagatctctcccgaaaaaaataacgtacaggacgatgcggcggaagaaaatcctcta
aaaaatggctcgtctggaaaaagtaaaacaaaggaagccttaaatccggtaaaaatggtg
aaaacttccgccgaaaaaaacgacggacttgaagccgtgacaaaaagcgcgctgacaatg
acacaaactaaaacaaaagaagtcttcaatcctgtagtaatagtgacagagatttctccc
gaaaagaataacgtacaggaagatgtggcagaaaacaggacggaggaaagtggtccaaaa
aataaaccaaaagaagtttttttaaatcctgtaataatcatgaaagaattttccgctgta
aaaaacgacggccctgaggctgcagaaagcgagccgtcaatgacacaaagtaaaacaaaa
gaagtcttagaaatttccgccgaaacaaatcaagtacccgaaaatgagacgaaagaggaa
ttgaaagttattaaacaagaagtaatagagctcgaagttggggttctggcctgggctaaa
cttggcaattttccctactggccgtgtctgattacgcaagaaccggcgagtggaacgcat
caaaaatacgttgtgaatcggatccatccgctttatcacgtgagatttttcggtgataaa
ggccgaaggtcatgggtgcatggcccaaacgtgatgcctttttacgccaaagacgatctc
gaacgtcttgcaaaaacgctcgaagtcgagggaaaatttaaaccatcctatatcaatgaa
tgttgctttataagacgcaccctaatgaagaaatggcaagaaggagtcgctgaagccgaa
tctttacaattcaaaacagtcgacgaacgcttgaattacttttcgaagatgtttgccaga
aaaaacgaactgaagcaagaaagacaaaaactgaaacgtgcgcggttatcagccgccgaa
aacttgtcgaaaaaagtgaaaatcgaagaaattgaaacacttgaattgatcaaaccggaa
ccagtcgaagttacttcgagccccgacactttaataaaaccccccaaaaagaagaatttc
ttaaagaaggaagaattttccgacgaacaactcgaagcgcgcaagaaactacgcaatcca
caagtgcgggaagaaatcccccaaccttcgagcgccccgaagttgcgtaaaaagccccaa
ggtgaaaattcaaactcggacaccgactccaaattcagcgacaacagctcgctcccaccc
tccatgcaatcgcaggcggccctgtttcgccgcaacaacatcttccggggaatccctcgc
gagaaagtgtgccaaatatgcgaaaaatccggggaaatcttcaaatgcaagggcccctgt
aacggcgtttaccaccccgagtgtgccatgaatcgcgtcgtggaacaaaaaagcagcgtc
gaaataatctcactcgaatcgaagcaacccttgcccgacctgggtacttcccccaactac
acgggaatgtccctagctgagaaaatcgaccatcggatgaaagaaataatgaaaaagttt
gaccaatcggtttattgcgaatcgaccgattccagtagcgatgagtacgttgtagaagag
gtggttagacaagcctcgcccccagcccaatcgaaactctccctcaccgtcaccgccacg
cccacgaagaaggaagtaccaatcataaagcacgtcactgccgacaatatcagttacatt
tgcgtgagtaatgaggcaccaaaggaggacaccacgggtttgaaatgcacgtggtgtgcc
tcagacgaggcccccttgtgcctcgtgtgtggggagatgggggcccaagggcgccagaag
tgctcgctgcaccaatgcggccgtttctaccaccccgagtgcctcaaactgtggccgcag
acgcagtggtcgctgaacgcgtcggacagcttcgtgtgtcctcggcacgtgtgccacacg
tgcatttccgacgatccccgagcggcgaactcgcgctgttcgagcgataaaatcgtaaaa
tgcctcaaatgccccgccacctaccactcgagcaattactgcgtgcctgcgggcacggaa
attctgaccgcctcccagattatatgcccgaggcattttaccagaaacaagcgcaactac
caatcaacgatcaacgccaattggtgtttcatttgttcgaacgggggcgacttgatctgc
tgcgagacgtgtccgaccagtgtgcacagggagtgtcttccgggtgatttgggcgaggtt
gagacgtttttctgtgaggactgccaatcggggcggttgcccctctatgatgagatcgtt
tgggtgaagctcgggtcgtttcggtggtggccggccgtgatcttgttcccgaatgaggtt
ccagataacgtgaaaaatatcccgcatagtaagggggagtttgtggtcaagttttacggg
acgtacgaccattattgggtcgggagagggaggacgttcttgtttcaggaaggcgatcgg
ggacattcgggttcggtgaagaagcgagtcgataacgcgttcgttaaggcgattgaggag
gcggcagcagcgcacgagttgaagaaacaatttaaggcgaggaaatttgaagagaagaat
agtggaatgaaaccgccaccgtacgttcggattaaggtgaataaacccgtggggaatgtg
agggtgtttgatgggaatacgagtaatacgacctcttgtgattgtgatccgaaccagccg
catccgtgtggacctgatagcgactgtctaaacaggctgcttttgaccgaatgcaacccc
gacgtgtgcccggccggcgaccgttgcaacaaccaatgttttgaaaaacgcgaatacccc
cctttggtgccccaccgcacactttaccgcggttggggcctcaaaacccttgctccaatc
cgaaaaggccaattcgtaatcgaatacgttggcgaaatgatcgacgaacaggagtaccaa
cgtcgcgtccaaaaaatgcacgaacaaaaagaagaaaactactatttcctcacgatcgac
aaggacaggatgttggatgccggtccgaaaggcaacgttgccagatttatgaaccattcg
tgtgacccgaactgtgagacacaaaaatggacagtgaatggcgacaccagagttggatta
ttcgcaaattgcgacattccagccggcactgagctcaccttcaattacaatttagaatgc
attgggaaagaaaagaagatctgtcactgtggcgcccccaattgtagtggctttattggt
gttaaagtgaaaacggataatcccccgaaaaagtcgactaaagccaagaagaagaaaaca
ccaccgcttgaatatgtcgataatgacaatccctgctttatttgcggcaagcaaggcgac
gttgccgcgtgcaataataagatttgtacaaagtattatcatttagcctgtgtggggctt
gaggcatggccggaagggaacaagtgggtgtgtcagtggcacaattgcaacatttgcacc
aagcgcacaattcgctgttgcgtgcgatgcattaactcgtattgtccgtctcactctgac
ggcaacgtccgttacgataagctgctagggttcgtctgtagtgagcatgactcgtcgaag
gagtccaacgcggtcgtgacgagccacgtgcccgcacccgattcgtgcgtcagtgatgag
ggcgtggtcacgtcgacgacttccgatgattcacgaatgaacggattcgtcacctccacg
ccggtgaagaaaaacgacaattcgtacgatgagagtgtggtgagttcgtccgaaaagaaa
ccgaagaaggttaaaaagaagaaagttgaaaacactgccaattttttactcgaaaacgaa
gtcaagctgaataatttcgcgcccgtgaagtatttgaggactagtaggagtaggaatagt
gaccctgaaagggacctcccgattcgaaaacgtaccagacttagatgtggaagttcgttg
tag

DBGET integrated database retrieval system