KEGG   Tribolium castaneum (red flour beetle): 662564Help
Entry
662564            CDS       T01046                                 

Gene name
ald
Definition
altered disjunction
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG9
AA seq 429 aa AA seqDB search
MSSLTSEFSSVRKPKREGNLTEPPFSLSTIKGRSCQRLKFMSIKPLRLDEIQKEIEEAEN
SAERANVYCPPSKEPRGCAPLQDSFDLNFSPLATPSKEPPCDKFVTPDNRIPAKVQCSVR
VKPALPGLSAGSPEVSFRRIRVNEVGYVVLNELGKGGSSQVFHCFNPETKQHRAIKVVSL
ENKVSAVGFINEVKMLQTLQKCNRIIKMFDYEIKEEEKKLLVVLEVGGTDLSKILKESAL
NNAHMPLYMLLYYWMEMLYAVRQIHESGIVHSDLKPANFLEVEGYLKLIDFGISSCIQSD
MTSVIKAVPEGSFNYISPEALSSETSSNASSPSFGKPKYKISYKSDVWSLGCILYQLVYR
RTPFQHITQIWVKLSAIVNPDHKIDYPDAHWVPQKLINTIKKCLQRNAKARPSIDELITD
YENMFHSLV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagttctctgactagtgagttttcttcagtgcggaagccgaaacgggagggcaattta
acggagccgccgttcagcctcagtacgatcaaagggcggtcatgccagcgcctcaagttc
atgtcaataaagccgctgcggcttgacgagatccagaaagagatcgaagaggcggaaaac
agcgccgaacgcgccaatgtgtactgcccccccagcaaggaaccccggggttgcgccccc
ttgcaggacagcttcgacctgaacttctccccgctggccaccccgtccaaggagcccccg
tgtgacaagttcgtgacccccgataacaggatcccggccaaggtgcaatgcagtgtgagg
gtgaagcccgcactgcccggtctgagcgccggctctccggaggtctcgtttcggagaatt
cgggtcaatgaggtggggtatgtggtgctgaatgagttggggaaagggggcagttcgcag
gtttttcactgttttaaccccgagactaagcaacatcgggcgattaaagtcgtttcactg
gagaataaggtctcggctgtggggttcatcaacgaggtgaagatgctgcagacgttgcaa
aagtgcaatcgcatcattaagatgttcgattatgagattaaggaggaagagaagaagttg
ttggtggtgttggaggttggagggactgatctgtcgaagattttgaaagagtcggcgctc
aacaacgcccatatgcccctctacatgctgctctactactggatggagatgttgtacgcc
gttaggcaaattcatgaaagcggaatcgttcattcggatttgaagccagcgaattttctc
gaagtggaaggttatttgaaactgatcgatttcggaatctccagttgcattcagagcgat
atgacgagtgtcataaaggcggtgcctgagggctccttcaattacataagtcccgaagcg
ctaagcagtgagactagttcgaatgccagcagcccctcgttcggaaaaccaaagtacaaa
attagttataagtctgatgtttggtcgctgggttgcatcttataccagctggtctaccgc
cgcacccccttccagcacatcacccagatctgggtgaaactttcggcaatcgtgaacccg
gaccacaaaatcgactacccggacgcccactgggtgccccaaaaactgataaataccata
aaaaagtgccttcaacgtaacgcaaaagccaggccctcgatcgacgaactaatcaccgac
tacgaaaacatgttccatagtttagtgtaa

DBGET integrated database retrieval system