KEGG   Tribolium castaneum (red flour beetle): 662635Help
Entry
662635            CDS       T01046                                 

Definition
Ubiquitin carboxy-terminal hydrolase CG4265-PA-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG4
AA seq 227 aa AA seqDB search
MALLPLESNPEFLHLLGVPNKWNIVDVYGLEQDDLAYITKPVLALILLCPNSEQFNKHAE
EESVKLKEEGQIITPDLFFVKQSVPNVCGTIALIHSVANNSEKLGIEGPFKHLLEKTKDL
TPEKRGELLFSCEDGESFNLMSVHQELAQEGQSEVNPNEPANNHFIALIEKDGHLYELNG
SKEFPVNHGPTTEDTFLEDAANVCRQFISRNAEDVNFTVMALTAAEN
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcactattacccctagaatcgaatcctgaatttcttcatttgttgggtgttcccaac
aaatggaacatcgtagatgtgtatggattagagcaggacgatttagcctacattacaaag
ccagtgttggctctgattttgctgtgtcccaacagtgaacaattcaacaaacacgccgaa
gaagaatccgtaaaactgaaagaggagggtcagattatcacccccgacttattttttgtg
aaacagtcagtgccaaacgtttgcggaacgatcgctttgatacattcggtcgcaaacaac
tcagaaaagctaggtatcgaagggccgttcaagcaccttttggaaaaaaccaaagactta
acacctgaaaaacgaggagagttgttattcagctgtgaagacggcgaatcctttaactta
atgtcagttcatcaggaactagctcaagagggacaatctgaggtcaacccgaacgaaccc
gccaataatcacttcatcgcactgatcgaaaaagacggacatttgtacgaacttaacggt
agtaaagaatttcccgtcaatcatggaccgaccactgaagacacttttctcgaggatgct
gcaaacgtttgtcgccagtttatttcgaggaatgccgaagatgtcaattttactgtgatg
gctttgaccgcagctgagaactga

DBGET integrated database retrieval system