KEGG   Tribolium castaneum (red flour beetle): 662635Help
Entry
662635            CDS       T01046                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     662635
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   662635
Ubiquitin system [BR:tca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    662635
  UBL-specific proteases (ULPs)
   662635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
LG4
AA seq 231 aa AA seqDB search
MALLPLESNPEVMNKFLHLLGVPNKWNIVDVYGLEQDDLAYITKPVLALILLCPNSEQFN
KHAEEESVKLKEEGQIITPDLFFVKQSVPNVCGTIALIHSVANNSEKLGIEGPFKHLLEK
TKDLTPEKRGELLFSCEDGESFNLMSVHQELAQEGQSEVNPNEPANNHFIALIEKDGHLY
ELNGSKEFPVNHGPTTEDTFLEDAANVCRQFISRNAEDVNFTVMALTAAEN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcactattacccctagaatcgaatcctgaagtcatgaacaagtttcttcatttgttg
ggtgttcccaacaaatggaacatcgtagatgtgtatggattagagcaggacgatttagcc
tacattacaaagccagtgttggctctgattttgctgtgtcccaacagtgaacaattcaac
aaacacgccgaagaagaatccgtaaaactgaaagaggagggtcagattatcacccccgac
ttattttttgtgaaacagtcagtgccaaacgtttgcggaacgatcgctttgatacattcg
gtcgcaaacaactcagaaaagctaggtatcgaagggccgttcaagcaccttttggaaaaa
accaaagacttaacacctgaaaaacgaggagagttgttattcagctgtgaagacggcgaa
tcctttaacttaatgtcagttcatcaggaactagctcaagagggacaatctgaggtcaac
ccgaacgaacccgccaataatcacttcatcgcactgatcgaaaaagacggacatttgtac
gaacttaacggtagtaaagaatttcccgtcaatcatggaccgaccactgaagacactttt
ctcgaggatgctgcaaacgtttgtcgccagtttatttcgaggaatgccgaagatgtcaat
tttactgtgatggctttgaccgcagctgagaactga

DBGET integrated database retrieval system