KEGG   Tribolium castaneum (red flour beetle): 662716Help
Entry
662716            CDS       T01046                                 

Definition
similar to CG13369-PA
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    662716
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     662716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 309 aa AA seqDB search
MSDSIVVVGSCMIDFVSYAARLPKKGETIHGTKFVTNFGGKGANQCVAAAKLGGKTTLIA
RVGDDVWGERYIANLKNQKVETKYVKQTPNFSSGIAQITVSETGDNQIVIVAGANKELGI
GDVEMAKSDIASAGVVVMQLETAPEVAIRAMELAKGVVLLFICILNGAPGLRQYDPRLLK
LPTIFCVNETEASEFTGLPVTTKQEAEAAAHHLISKGCNSVVLTLGAEGALYLERNSNCV
FLTCPAVQSVDSTGAGDAFIGALAYLLANNRKLPMESILKSACFIASDSVTRSGTQISFP
GQEILSRCT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtccgattctattgttgtggtcggttcttgcatgattgactttgttagttacgccgcc
cgtttgcctaaaaaaggcgagaccatacatggcaccaaattcgttactaatttcgggggc
aagggggccaaccagtgcgtggctgcggcgaaactcgggggtaaaaccaccctaattgct
agggttggggacgatgtatggggtgaaagatacattgctaatttgaaaaatcaaaaagtt
gagaccaaatacgtgaaacaaacgccgaatttttcaagcggaatcgcccaaatcacagtt
tctgaaacgggagataatcaaattgtgattgtggcaggtgctaataaagaactgggtatt
ggagacgtcgaaatggccaaaagtgacatagcctcggccggtgttgtggtcatgcagctg
gaaaccgcgcctgaggttgccataagggctatggagttggcaaaaggggttgtcctactt
tttatatgcattttgaatggggcgcctggtttgagacaatacgaccctagattgctcaaa
ctaccgacaattttttgtgttaatgagacagaagcgtctgaatttacaggactaccggtc
acaaccaaacaagaggcagaagcggccgcacaccacctaatatccaaaggttgcaacagt
gtggttttaaccctaggtgccgagggggccttgtatcttgaaagaaattcaaattgtgtt
tttcttacatgtcctgccgtccaaagtgttgactcaacaggcgccggcgatgcttttatc
ggtgccttggcttatctcctggcaaataaccgcaaacttccgatggaaagtatcctcaaa
agtgcttgtttcatcgcttcggacagtgtcactcgatcggggacacaaatcagtttcccg
gggcaggaaattttaagcagatgtacttaa

DBGET integrated database retrieval system