KEGG   Tribolium castaneum (red flour beetle): 662841Help
Entry
662841            CDS       T01046                                 

Definition
nuclear pore complex protein Nup205
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    662841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 1933 aa AA seqDB search
MSDALNKSEDLWSSYKGLKKIIWKSLSDDPDDVYAVEFENTLRKYKQNFFSLLQNQPKNA
KSREELKKGMVDGIVIKGLGHQILSKELYQEAIILSDMYDMNEFVALDLLCTAQIQMSFY
PGLPRGLVAVLLYYDGRKSLVQSLRYLVQARTGVQWSVSIKPDVEKFVTTYTDQLMEGGL
FNRIFELLRTLDLSKEMDKLQENLALGGPRHRRQVMDLFQDIRVILADIVFTWAAQSGLP
KAPTLALINYLRQAEIEEEASGKLDNVNLYLIMALLSAFDLSVLHSREDGEEAVQSLPIL
SDPDYVNTVINELQPGKPKWKCEGLQAVATFGLAVCLASLRLIPQNQQFQDVINKEETFV
DAAIENHVFEFIHNIILENEVLYKETFVYKRMHHLITDFIVYMYPKVKELRIKADEIART
VQIYTREGLDAPANLPRYFEYLLLTIAKVYSKDILNTEYVLSYWSPVELNSTQYSSHRSS
SRAVSLFKFVRLAGDMLPPTLFVPYLTMLSSLSSCPQAARHCFNMLKQVGPQLTATLSWD
HFFTSFAQYYNNLRQELPPVTDTVYRNTYLKGVSPQELEGLHAVLLLIRTIADHDEFSRL
ALCEHPGWAPLTILLGLVGCSVPIPLKSDLLLTLASLSKSAENAAQMWDNLETSQILVTV
PTTSSYAPRGIQTELDEIEARLEEYPLTRAMLKLLDVLTDFGIPRTLGAGPRPPGFDPYL
SFIVNSIFLKFHTRSYRNSSEKWEIAKLCLKLFEKFLTQYDPQISDFPKKNLPSEFNPPP
GYHLMLQLNNKSELLSVILDIIDEGNRLFDTYVSFPNQQLLEECTLLCLNIIHSVLALHG
KFVNVLTASSASILLTNLTKLLLTINRRTGKPDHCVNIAKYVSYQPYLLKHSHVVVKILN
HVTNTPLLHNQFINIFLSSDAKDEIKHGFVLSLDSDVAEEDAQLTIKTKLEILKLIKHCL
PYTAPNFSHFLLGFDIRKDISKTEFQYSGVLDFPRSCLHSIISLMEAEVVKESSITSPLL
ESAYEVIFLLSSNSKTYGPVLRFLRLNKKFFTYHLNLCRSRINEGLHVLNQISWLMKTLA
VELKICGQSKQVSYMKQLTHFLVSLPQIENNTNQDPFSATYKEDVREGNYMFLERISNNF
LVNLIPHFEFKPDTVQAPEWQFFDAKVLNVLLDHCVQDGGQKLIDLKKLHQRLYDEVKLL
QGTAVMGQIQAVTQEIPKVLKYALELNKNKEKYASIVQFVDAWRQVVEVLMVFIPHEILS
VKESQLVGVCFVLNLLKRVGKIELLPEVGQLLSGAVLLIIENLRKCHIYERKQQNFSSET
DIPASMLQMLLGSLKEVLENLIEWIMVSNVTDEKLKINLYAALVTLLELASLEKPPESAS
LSNSMYVSRLDNSRVSIENHLQNFKMSTDSLAKFGERLVEVMCQDCIGGYDVSRMLALSS
FSVLITLSGNINWIAYMSGRGYLKVIIQSILDSNNDLERLLEPGQTSIKPLYVYMSKVLF
LGRLAGTRVGAELLLEQKIFSCFGNMNVFSYHPEIAKTWRPNDILESFVPPPEELYLQMW
LPTLEVCNAILTTLGTDNQSAVVQIMYFILNHLDVVETILRSGSPSLSRQFLKELSLLTS
VIARTANNNLVNILENPDIVHDQRAHLFRIQKLTLALLPKFILTDEVVKELVNRQGERSH
TFQTSERLLFAMQVMANLLSYSRNVVANHDVEHGGIGVIFQPTLKDPGLNSVDLKNGLNF
NDQTPSLGVVVQQLINVVNHHHQEKFTYELLERKIKEIPVMDSTDVDEFIEESLNLQDVN
TKREHVYDLISNRLEKKRKEMQYCCYIIENAIYLIWVHLDYYMLKAIPKVKNFGSLAVKS
PMTPGTLASATEATWKVSTDDISNLKHGLVSIFNDSFTKQLLETIQDQSDLDKGFVETML
RKIIRLIQFVPVK
NT seq 5802 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgcattaaacaagtcagaagatttgtggagttcctacaaggggctgaaaaaa
atcatctggaaaagcctgagcgatgaccccgatgatgtctacgccgtcgaattcgaaaat
acgttacgcaaatacaaacaaaactttttttccctcctccagaatcagcccaaaaatgca
aaaagccgcgaggagctcaagaagggaatggtggacgggatcgtcatcaaaggcctcggc
caccaaatcctctccaaggagctgtaccaagaagccattattttatcagacatgtatgac
atgaatgagtttgtggccctggacctcctgtgcaccgcccaaatccagatgtctttctac
cccggccttccccgcggcctggtcgccgttttgctgtactacgacggccgtaagtcccta
gttcagagtttgcggtacttggtccaggcccggacgggcgtccaatggagcgtcagcatt
aagcccgacgttgaaaaattcgtcactacttacacagaccagttgatggaaggcggtttg
ttcaaccgcattttcgagttattgcgcactttagacttgagtaaagagatggacaagttg
caagaaaaccttgccttaggcgggccccggcaccggcgccaagtcatggacttgttccaa
gacattcgcgttattctcgctgatattgttttcacttgggcggcgcagtccggccttccc
aaagcccccactttggctttgattaattacttgcgccaggcggaaattgaagaagaggcc
tcggggaagttggataatgttaacttgtatttaattatggccctgttgtcggcgttcgat
ctcagcgtgttgcattcgcgggaagatggggaagaggccgtgcaaagtctgccgatattg
tcagaccctgattatgtcaacacggttattaatgagttacaaccggggaaacccaagtgg
aagtgtgaggggctccaagctgtggctacgttcggtctggctgtttgtctagcctcgctt
aggcttattccccaaaatcagcaattccaagatgttatcaacaaagaagagacttttgta
gacgccgctattgaaaatcacgtctttgaatttatccataacattattcttgaaaatgaa
gttttgtacaaagaaactttcgtctacaaacggatgcatcacttgattacggattttatc
gtatatatgtatccaaaagtgaaggaattgcggatcaaagccgatgaaatcgccagaact
gttcagatttacacacgggagggactggacgctccagcgaacctcccacggtactttgag
tacctcctcttgaccatagccaaagtttactcaaaagacatcctcaacactgaatacgtg
ctaagttactggagtcccgtcgaacttaattcaactcaatacagttctcatcgttcgtca
tctcgtgccgtttcgttgtttaagtttgtccgtcttgcgggtgatatgttaccacccaca
cttttcgttccctatttaacaatgttaagtagcctgtcgtcatgtcctcaagcagctcgc
cattgtttcaacatgttgaaacaagtggggccccaactaaccgccaccctgtcttgggac
cacttcttcacgtcctttgcccagtattacaataatttgcgccaggaattaccccctgtg
accgacacagtttaccgaaatacgtaccttaaaggcgtctcccctcaagagctggaaggc
cttcacgctgtgttgttgctaatcaggacaatcgccgaccatgatgagttttcaaggttg
gcactatgcgagcatccgggttgggcccccttgacaattctgttgggtttggtgggctgc
tcagtgccaattccactaaaatccgatcttttgctcactctggcttcgttaagtaaatcg
gcggaaaatgcggcacagatgtgggataatttggaaacgtcccaaatattagtaacggtg
cctacaacctcgagctacgcccccagagggattcagacggaattggacgagattgaggcc
cgacttgaggagtatcccttgaccagagccatgttgaagcttctggacgttttgaccgat
tttggaatcccgaggactttgggggccgggcccaggccccccggcttcgatccgtacttg
tctttcatcgtaaattcaatctttctcaaatttcatacgaggtcgtaccggaattcgtct
gaaaagtgggaaatcgccaagctttgtctgaaactgttcgagaagtttttgacacagtac
gatccacaaattagcgattttcccaaaaagaacctcccgtctgagtttaatccgcccccg
gggtaccacttgatgctccagttgaataacaaatctgagttattgagtgttattttggat
attatcgatgaagggaacagactgtttgatacttatgtttccttccccaaccaacagttg
ttggaagaatgtaccttgctttgcttgaacatcattcattcggttttggctttacacggg
aaatttgttaatgtgttaacggcttcatcggcttctatccttttgacgaatttaactaaa
cttctcttgactatcaataggaggactggaaagccggaccattgtgtcaatattgcgaaa
tatgtgagctaccaaccctatttgttgaaacatagccacgtagtggtgaaaatactgaac
catgtgaccaacacaccacttttgcataatcaatttatcaatatcttcttgtcctcggat
gcaaaagatgaaatcaaacacgggttcgtgctcagtttggacagtgatgtggccgaggag
gacgcacaattgaccattaaaacgaaattggaaattcttaaactgataaaacactgtctc
ccctacacggcccccaatttcagtcacttcctcctaggcttcgatattaggaaagatatt
tcaaagaccgaattccagtattcgggagttttggattttccgcgatcttgtctacattct
ataatttcgttaatggaggccgaagtcgtgaaagaaagttccattacatcgccattgctc
gaatcggcatacgaagtgattttcctattgtctagtaacagtaaaacgtacggccctgtc
ttgcgcttccttcgactcaataagaaatttttcacgtatcacttgaatctgtgccgcagc
cgaataaacgagggtctgcacgtcctgaaccagatttcgtggttgatgaaaacgctcgct
gtcgagttgaaaatctgcggccaaagcaaacaagtcagttatatgaaacagttgactcac
tttttagtcagcttgccgcaaattgagaacaacacgaatcaagatcccttcagtgcgacc
tacaaagaggacgtcagagagggcaattacatgttcctggagcgcataagtaacaatttt
ctggtcaatttgatcccgcattttgagttcaaacccgacactgtgcaagcccccgagtgg
caatttttcgatgccaaggtcctcaacgtgttgctcgatcattgcgtacaagacgggggg
caaaaactaatcgacttaaagaagcttcaccagaggctttacgacgaggtgaagctcctc
caaggcacggctgtgatggggcaaatccaggcggtgacccaggaaatccccaaggtgttg
aaatacgccctcgagttgaacaagaacaaggaaaagtacgcttcgattgttcaattcgtg
gacgcctggaggcaagtcgtggaagtcctcatggtgttcatcccgcacgagatattatca
gtcaaagaatcccaattggttggcgtctgtttcgttttaaatctcttgaaacgtgtgggt
aaaatcgagctcttgcccgaagttggtcagttgttgtcaggtgcggttttgttaataatc
gaaaatctgcgaaaatgccacatctacgagcgcaaacagcagaacttctcgtccgagacg
gacatcccggccagcatgctgcaaatgctcctagggtcgcttaaggaagttttggaaaat
ttgattgagtggatcatggtgtccaacgtcacggatgaaaagctcaaaatcaatctttac
gcagctttggtcactttgctggagttggcaagcttggagaagccccccgagagtgcgtcc
ctctcgaacagcatgtacgtgagccggctggacaactcgagggtcagcatcgagaaccac
ttgcagaattttaaaatgtcgaccgatagtttggccaaatttggcgagaggctggtcgag
gtgatgtgccaggactgcatcggcgggtacgacgtgtcccggatgttggcattgtccagc
ttcagtgtcttgatcacactgtcggggaatatcaactggattgcctacatgtcggggcgc
gggtacttgaaagtgataatccagtcgattttggacagtaataacgacctggaacggctg
ctcgaacccggccaaacgtccatcaagccgttgtatgtctacatgtcgaaggttttgttt
ctggggcgcttggcgggcacgagagtcggggccgaattgctcctcgagcagaagattttc
tcctgctttggcaacatgaacgtgttcagttaccacccagagattgcgaaaacgtggcgc
ccgaacgatattcttgaaagtttcgtgccaccacccgaggagttgtacctccagatgtgg
ttgccaactctggaagtttgcaacgcgattttaacgaccctcgggaccgacaaccaatcg
gctgtggtccagataatgtattttattttgaaccatctggacgtggttgagacgattctc
cggtcggggagtccctccctctcccgtcagtttttaaaagagttgtctctactgacttcg
gtgattgcccgcactgccaacaacaatctagtgaatatcctcgaaaatccggacattgtg
cacgaccaaagggcgcatctgtttcggatacagaagctgacgcttgcccttttgcccaaa
tttatcctcaccgatgaggtggtgaaagagctcgtcaataggcaaggcgagcgttcgcac
actttccagacctcggagcggttgctctttgccatgcaagtgatggcgaacttgttgtcg
tactcgcggaatgttgtggccaatcatgatgtggagcacgggggaatcggggttattttt
caaccgactttgaaagaccctggtttaaattcggttgatttgaagaacgggctgaatttt
aacgaccaaacgccgtctttgggcgtggttgtgcagcagttgataaatgttgtgaaccac
caccaccaagaaaaattcacttatgagttgttggagaggaagattaaggaaatcccggtc
atggatagcaccgatgttgatgagtttatcgaagaatcgctgaatcttcaagatgttaac
acgaaaagggagcatgtgtacgatttaatctcgaacagactggagaagaagaggaaggag
atgcagtactgttgttatattatcgaaaatgcgatttatttgatttgggtgcacttggat
tattacatgctgaaggcgatccccaaagttaagaatttcggttctttggcggtaaagtca
ccaatgacaccagggactctagcatctgctacggaagcgacttggaaagtatcaacagat
gatataagtaatctcaagcacggtttagtgtcaatttttaacgacagctttactaaacag
ttgttggagaccatacaagaccaatccgacctggacaaagggttcgttgaaacaatgttg
agaaaaataatccgtttgatacaatttgtgccagttaagtag

DBGET integrated database retrieval system