KEGG   Tribolium castaneum (red flour beetle): 662889Help
Entry
662889            CDS       T01046                                 

Definition
non-stop CG4166-PA-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     662889
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   662889
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     662889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 482 aa AA seqDB search
MSIVGCQHLQSYKKTSKNKNTFKWIHAVFVVNSTSKSLKTKLCNSRCRVCKKRGPFLHAC
LECVFFGCHKHIREHAKSQKHSMSMDLTYGQMHCNQCHDYIYDSEIDAIANDNKMKSKTC
KKRLFEIDTWNPTSDERDYLRSKTKKICITPDSTIGLRGLLNLGQTCFMNCIVQALMHTP
LLRDYFLTEEHNCKGMSGRCLVCEVSKLFQEFYNGTRVPLALHELLHLIWTHARHLAGYE
QQDAHEFFIATLDVLHQHCLETMPDLKPVNVGKNSRCPCIIDQIFTGGLQSDVVCQKCNG
VSTTIDPISDFSLDLGPVTVGGRPPTSLVDCLERFTRAEHLGENSKIMCSNCQSKQESTK
QLTMNTLPIVISFHLKRFQHMNEMEKKISTTISFPEMLDMTPFMSRSKTDSPFPSDNRYS
LFAVINHIGNSINVGHYTAYVRQLQDYWYKCDDHVITRATLKEVLDSEGYLLFYHKHVLD
YD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagttgggtgtcaacacttgcagtcttacaagaaaacgagcaaaaacaagaac
actttcaagtggatccacgccgtgttcgtggtcaactccacctcaaagagcctcaaaacc
aagttgtgcaacagccgctgtcgcgtgtgcaaaaagcggggccccttcctgcatgcctgc
ctcgagtgtgtctttttcggatgccacaagcacatccgggagcatgccaagagccagaaa
cactccatgtccatggacctgacctacgggcagatgcactgcaaccaatgccatgactac
atctacgattccgaaatcgacgcaattgcgaacgataataaaatgaagtcgaagacttgc
aagaaacggctgtttgagatcgacacgtggaatcctacgtctgatgagagggattatttg
aggagcaagacgaagaagatttgtattacgcccgattcgacgatcgggctaagggggctg
cttaatttaggtcagacgtgcttcatgaattgtatagtgcaagcactgatgcacaccccc
ttgttgcgcgactacttcctcacagaggagcataactgcaaggggatgtcgggacggtgc
ctcgtttgcgaggtctccaagcttttccaggagttttataacggaactcgcgtccctttg
gccctccacgagctcttgcatttaatctggacgcatgcccggcacttagccggctatgag
cagcaagacgcccacgaatttttcatcgcgactctggacgtgctccaccagcactgtctc
gagacaatgcccgatttaaagccggtgaatgtggggaaaaactcgcgatgcccctgcatt
atcgaccagatttttaccggggggttgcaaagtgacgttgtttgtcagaaatgcaatggt
gtttctactacaattgatccaatttcggacttttcgttagatttgggtccggtcacggtt
ggcggacggccacctacctcacttgtcgattgtttagagaggttcacaagggccgaacat
ttaggcgaaaattcgaaaatcatgtgttcgaattgccaatcaaagcaggaatcgacgaaa
caattgactatgaatacgcttccgattgttatcagttttcatttaaaacgctttcagcac
atgaacgagatggagaagaaaatctctactacgatttcgtttcctgaaatgctagatatg
accccgtttatgagcaggtctaagacagactcgccttttccctctgataacagatactcg
ctctttgccgtcattaaccacattggcaactccataaacgtgggtcattacaccgcttat
gtcagacagttgcaagactattggtacaaatgcgacgatcacgtcatcacaagagccact
ctcaaggaggttctagactcggaaggatatttactcttttaccacaagcatgtcctagat
tacgactaa

DBGET integrated database retrieval system