KEGG   Tribolium castaneum (red flour beetle): 662889Help
Entry
662889            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase nonstop
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     662889
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   662889
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     662889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 512 aa AA seqDB search
MGNKSHTKPRFSKKMSIVGCQHLQSYKKTSKNKNTFKWIHAVFVVNSTSKSLKTKLCNSR
CRVCKKRGPFLHACLECVFFGCHKHIREHAKSQKHSMSMDLTYGQMHCNQCHDYIYDSEI
DAIANDNKMKSKTCKKRLFEIDTWNPTSDERDYLRSKTKKICITPDSTIGLRGLLNLGQT
CFMNCIVQALMHTPLLRDYFLTEEHNCKGMSGRCLVCEVSKLFQEFYNGTRVPLALHELL
HLIWTHARHLAGYEQQDAHEFFIATLDVLHQHCLETMPDLKPVNVGKNSRCPCIIDQIFT
GGLQSDVVCQKCNGVSTTIDPISDFSLDLGPVTVGGRPPTSLVDCLERFTRAEHLGENSK
IMCSNCQSKQESTKQLTMNTLPIVISFHLKRFQHMNEVKTHTKSKQKSLISSQMEKKIST
TISFPEMLDMTPFMSRSKTDSPFPSDNRYSLFAVINHIGNSINVGHYTAYVRQLQDYWYK
CDDHVITRATLKEVLDSEGYLLFYHKHVLDYD
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataaatcccacacaaagccgcgtttttcgaaaaaaatgagcatagttgggtgt
caacacttgcagtcttacaagaaaacgagcaaaaacaagaacactttcaagtggatccac
gccgtgttcgtggtcaactccacctcaaagagcctcaaaaccaagttgtgcaacagccgc
tgtcgcgtgtgcaaaaagcggggccccttcctgcatgcctgcctcgagtgtgtctttttc
ggatgccacaagcacatccgggagcatgccaagagccagaaacactccatgtccatggac
ctgacctacgggcagatgcactgcaaccaatgccatgactacatctacgattccgaaatc
gacgcaattgcgaacgataataaaatgaagtcgaagacttgcaagaaacggctgtttgag
atcgacacgtggaatcctacgtctgatgagagggattatttgaggagcaagacgaagaag
atttgtattacgcccgattcgacgatcgggctaagggggctgcttaatttaggtcagacg
tgcttcatgaattgtatagtgcaagcactgatgcacacccccttgttgcgcgactacttc
ctcacagaggagcataactgcaaggggatgtcgggacggtgcctcgtttgcgaggtctcc
aagcttttccaggagttttataacggaactcgcgtccctttggccctccacgagctcttg
catttaatctggacgcatgcccggcacttagccggctatgagcagcaagacgcccacgaa
tttttcatcgcgactctggacgtgctccaccagcactgtctcgagacaatgcccgattta
aagccggtgaatgtggggaaaaactcgcgatgcccctgcattatcgaccagatttttacc
ggggggttgcaaagtgacgttgtttgtcagaaatgcaatggtgtttctactacaattgat
ccaatttcggacttttcgttagatttgggtccggtcacggttggcggacggccacctacc
tcacttgtcgattgtttagagaggttcacaagggccgaacatttaggcgaaaattcgaaa
atcatgtgttcgaattgccaatcaaagcaggaatcgacgaaacaattgactatgaatacg
cttccgattgttatcagttttcatttaaaacgctttcagcacatgaacgaggtaaaaacc
cacacgaaatccaaacaaaagtcactcatttcgtcgcagatggagaagaaaatctctact
acgatttcgtttcctgaaatgctagatatgaccccgtttatgagcaggtctaagacagac
tcgccttttccctctgataacagatactcgctctttgccgtcattaaccacattggcaac
tccataaacgtgggtcattacaccgcttatgtcagacagttgcaagactattggtacaaa
tgcgacgatcacgtcatcacaagagccactctcaaggaggttctagactcggaaggatat
ttactcttttaccacaagcatgtcctagattacgactaa

DBGET integrated database retrieval system