KEGG   Tribolium castaneum (red flour beetle): 662917Help
Entry
662917            CDS       T01046                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     662917
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   662917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 411 aa AA seqDB search
MADQSNQVRRPMLSIDLPNSVNSIGGFRPLPSQPGATSERLGAAAGTNRPKMSLPTISKS
TVDPTIDRTRFGPSERNKQQRDSRFKICQSMNSSGKLQIGGKTYDFTSDDLQDIGEIGRG
GFGTVNKMVHRKSGTVVAVKRIRSTVDEKEQKQLLMDLDVVMKSNECHYIVQFYGALFKE
QGDCWIVMELMDTSLDKFYKFIYDKLGDRIPEEILGKIALATVKALNYLKEKLKIIHRDV
KPSNILLDRKGNIKLCDFGISGQLVDSIARTRDAGCRPYMAPERIDPQTAKGYDVRSDVW
SLGITLMEVATGRFPYPRWSSVFDQLHQVVNGEPPRLTENHNANTFTSEFVNFVNTCLIK
DEHSRPKYKRLLEDPFILRAQKEKVDVAAYVSRIMDEMANNGISAFTTNQQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcagtccaatcaagtccggaggcctatgctgagcatagacttgcccaacagt
gtgaattccatcgggggctttcgcccgctgcccagccagccgggggccaccagcgagcgt
ttgggggccgcagccgggacaaaccgccccaaaatgagcctcccgaccatctccaagtcc
acagtcgatcccacgattgatagaacgcgttttggaccgagtgaaagaaataaacagcaa
agggattcccggttcaaaatttgccagtcgatgaattcctcagggaagctccaaattggg
ggcaaaacctacgattttacgtccgatgatctgcaggacattggggagataggaaggggc
ggttttgggactgtgaataaaatggtgcatagaaagtcgggaactgtggttgcggtgaag
agaataaggtcaacggttgatgaaaaggaacagaaacaactgttgatggacttggatgtg
gtgatgaaaagcaacgagtgccattacatcgtgcagttttatggggcgctgtttaaggag
cagggggattgctggatcgtgatggaactaatggacacctcattggataaattctacaaa
ttcatctacgacaaactgggcgatcgaattccggaagaaatcctcggaaaaatagcccta
gcgactgtgaaagccttaaactacttaaaggagaaactaaaaataatacatcgagatgta
aaaccaagcaatattttactagacaggaagggaaacatcaagttgtgtgattttggaatt
tcgggacagttggtcgattcaattgcacggacacgtgatgctggatgtcgcccgtatatg
gctcccgagagaatcgatccacagacggccaaaggctacgacgtgcgaagcgatgtctgg
tcgttgggaataacgctgatggaggtggccaccggtcgttttccctacccgagatggtcg
agcgttttcgaccaattacaccaagtcgttaacggggaacccccgcgccttaccgaaaac
cataacgccaatacttttacgtcagagtttgttaattttgtaaatacttgtttaataaaa
gacgaacactccagaccaaagtacaagcgactgctcgaagacccgttcattttgcgggcg
cagaaggagaaagtggacgttgcagcctacgtttcgcgcatcatggacgagatggcgaac
aacgggatcagcgcgttcacgacgaaccagcagtga

DBGET integrated database retrieval system