KEGG   Tribolium castaneum (red flour beetle): 662917Help
Entry
662917            CDS       T01046                                 

Definition
dual specificity mitogen-activated protein kinase kinase 4 MAPKK4-like
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 399 aa AA seqDB search
MADQSNQVRRPMLSIDLPNSVNSIGGFRPLPSQPGATSERLGAAAGTNRPKMSLPTISKS
TVDPTIDRTRDSRFKICQSMNSSGKLQIGGKTYDFTSDDLQDIGEIGRGGFGTVNKMVHR
KSGTVVAVKRIRSTVDEKEQKQLLMDLDVVMKSNECHYIVQFYGALFKEGDCWIVMELMD
TSLDKFYKFIYDKLGDRIPEEILGKIALATVKALNYLKEKLKIIHRDVKPSNILLDRKGN
IKLCDFGISGQLVDSIARTRDAGCRPYMAPERIDPQTAKGYDVRSDVWSLGITLMEVATG
RFPYPRWSSVFDQLHQVVNGEPPRLTENHNANTFTSEFVNFVNTCLIKDEHSRPKYKRLL
EDPFILRAQKEKVDVAAYVSRIMDEMANNGISAFTTNQQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcagtccaatcaagtccggaggcctatgctgagcatagacttgcccaacagt
gtgaattccatcgggggctttcgcccgctgcccagccagccgggggccaccagcgagcgt
ttgggggccgcagccgggacaaaccgccccaaaatgagcctcccgaccatctccaagtcc
acagtcgatcccacgattgatagaacgcgggattcccggttcaaaatttgccagtcgatg
aattcctcagggaagctccaaattgggggcaaaacctacgattttacgtccgatgatctg
caggacattggggagataggaaggggcggttttgggactgtgaataaaatggtgcataga
aagtcgggaactgtggttgcggtgaagagaataaggtcaacggttgatgaaaaggaacag
aaacaactgttgatggacttggatgtggtgatgaaaagcaacgagtgccattacatcgtg
cagttttatggggcgctgtttaaggagggggattgctggatcgtgatggaactaatggac
acctcattggataaattctacaaattcatctacgacaaactgggcgatcgaattccggaa
gaaatcctcggaaaaatagccctagcgactgtgaaagccttaaactacttaaaggagaaa
ctaaaaataatacatcgagatgtaaaaccaagcaatattttactagacaggaagggaaac
atcaagttgtgtgattttggaatttcgggacagttggtcgattcaattgcacggacacgt
gatgctggatgtcgcccgtatatggctcccgagagaatcgatccacagacggccaaaggc
tacgacgtgcgaagcgatgtctggtcgttgggaataacgctgatggaggtggccaccggt
cgttttccctacccgagatggtcgagcgttttcgaccaattacaccaagtcgttaacggg
gaacccccgcgccttaccgaaaaccataacgccaatacttttacgtcagagtttgttaat
tttgtaaatacttgtttaataaaagacgaacactccagaccaaagtacaagcgactgctc
gaagacccgttcattttgcgggcgcagaaggagaaagtggacgttgcagcctacgtttcg
cgcatcatggacgagatggcgaacaacgggatcagcgcgttcacgacgaaccagcagtga

DBGET integrated database retrieval system