KEGG   Tribolium castaneum (red flour beetle): 663011Help
Entry
663011            CDS       T01046                                 

Gene name
TcTBH
Definition
tyramine beta hydroxylase
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    663011 (TcTBH)
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     663011 (TcTBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 572 aa AA seqDB search
MRFLIAIIILTCLKSSHSGEIFHVPLNGDGSISLNWVLDYPTQTVTFEVHLPENFGWFAI
GFSDQGAHFPADYCILWKTIKRKIQFEDTWADTTGIIRLDRQQDCQNFKIKRAGNVTKFT
FRRKFDTCDFEDYVIEDGTTHIVWARGAHPLYKVVGLNISSPEKEQGMVRVQLLKNTNVK
AILPNYVQTLDVFAHEVRVPDKETTYWCHVHKLGEEFKEKHHVYRYEAHIPSSSEGLVHH
MEVFHCVAPPNQQIPLYVGNCFAKDRPKETQVCKRVLAAWAMGAPPFTYPEEAGLPLGGP
DFNPYVMLEVHYNNPEHKTGFVDSSGIRFHVSSKLKKMDAGVIELGLEYTDKMAIPPGQE
AFPLTGYCVSECTAVSLPPEGITIFGSQLHTHLTGVKVYTRHIRDGIELRELNRDDHYST
HFQEIRRLKQPVKVLPGDALVTRCYYNTQERENITLGGFSITDEMCVNYVHYFPATQLEV
CKSAISDQALSTYFNYMKEWEGQKISLHHVISDNYKSIKWNKMRVQLLSDVYHEAPLSMQ
CNMSSGDRFPGYWENTPITPILTPLPPPPRTC
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttcttatcgcaatcataatcctgacgtgtctgaaaagttcacactccggtgaa
attttccacgtcccgttgaacggtgatgggtccatttccctcaactgggtcctggattat
cccactcaaaccgtcactttcgaggtccacctcccggaaaatttcggctggtttgcgatt
ggtttttccgaccaaggggcgcatttcccggccgattattgcatactatggaagacaatc
aaacggaaaattcaatttgaggacacgtgggccgacaccactgggattatacggctggac
cgccaacaagattgccaaaatttcaaaataaaacgcgcgggaaatgtaaccaagtttacg
tttcggcgcaaattcgatacttgcgactttgaggattatgttatcgaagatgggacaaca
catatcgtgtgggcacgtggggcccaccctttgtataaagtggtggggttgaatattagc
tcccctgagaaggagcaaggcatggtgagggtgcaattgttgaaaaataccaatgtgaag
gcgattttgcccaattatgtgcaaactttggatgtttttgcccatgaagtgagggttccg
gacaaggaaacgacgtattggtgtcacgtccataaactgggggaagaatttaaggagaaa
caccatgtttacaggtacgaggcccatattccgagtagtagtgaaggtttggtccatcat
atggaagtgtttcattgtgtggcacctccgaatcaacaaattcccctatatgttggcaac
tgttttgctaaagacagacccaaagagacgcaagtttgtaaaagagtgctagctgcgtgg
gccatgggggcaccacctttcacatatccagaggaggccgggcttcccctcggcggtccc
gacttcaacccctacgtcatgctcgaggtgcattacaacaatccggagcataaaaccgga
tttgtggatagttccggaatccggtttcacgtctcatcaaaattgaaaaaaatggacgct
ggagttatcgaattagggttggagtataccgacaaaatggcgattcctccaggtcaggag
gcgtttcctttgaccggatattgcgtcagcgagtgtaccgctgtgagtttgccacctgaa
gggattacaatttttgggtcacagttacacactcacctcacaggggttaaggtgtacact
aggcatataagggatgggattgagttaagggaactgaatagggatgatcattacagtacg
cattttcaggaaatacgcaggttgaaacaaccggttaaagtcttaccgggcgatgccttg
gttacgcgatgttattataacacacaagagcgggaaaatatcacacttggagggtttagt
atcacagatgagatgtgtgttaattatgttcattacttcccagccactcaattggaggtt
tgcaagagcgcaattagtgaccaggctttaagtacttacttcaactacatgaaagaatgg
gagggccaaaaaatttcgctccaccacgtaatttcagataattacaaatcaatcaaatgg
aataaaatgcgcgtccaattactgagcgatgtgtaccatgaggcccccttgagcatgcag
tgcaatatgtcaagtggtgacagatttcccggttattgggaaaacacccccatcaccccc
attttaacgcccctacccccacccccacgaacatgttaa

DBGET integrated database retrieval system