KEGG   Tribolium castaneum (red flour beetle): 663357Help
Entry
663357            CDS       T01046                                 

Gene name
Snf1a
Definition
SNF1A/AMP-activated protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tca04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tca04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:tca04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG7
AA seq 526 aa AA seqDB search
MGDVTQGAQGQMKIGHYILGQTLGVGTFGKVKIGEHQITGHKVAVKILNRQKIKSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKHGKLQEHEARRF
FQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMMDGEFLRTSCGSPNY
AAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNK
SVVNLLCQMLQIDPMKRASIEEIKKHEWFQKDCPAYLFPSPVDQDSSVIDTDAVAEVCDK
FGVQEKEVHNALLSGDPHDQLAIAYHLIIDNRRIADEAAKAEIKDFYIAGSPPPVSMSPS
PSPCDFGSSPLKPHPERIAPLRDRMASNHAASGDRGRVKRAKWHLGIRSQSKPHDIMMEV
YRAMKALDYEWKVINPYHVRVRHKNPLHERFVMMSLQLYQVDYKSYLLDFKSLANEEAES
NTAAPIMGSLPTPVQSGESTLNAKPKGHYTMEFFEMCAALIIQLAR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgtgacccagggggcgcaaggccagatgaagatcggccactacatccttggc
cagactttgggtgtggggactttcggcaaagtcaaaatcggggaacaccaaatcacgggg
cacaaggtggcggtcaaaattctaaatcggcagaagatcaagagcctggacgttgtgggg
aagatcaggagggagattcagaacttgaagctgtttcggcacccgcatattatcaagctg
tatcaggtgatcagcacgccgactgatatttttatgatcatggagtacgtctcggggggc
gagttgttcgattacattgtgaagcacgggaagttgcaagaacatgaggcgaggcggttc
ttccagcagatcatttcgggggttgattactgccaccggcacatgattgtgcaccgagac
ctgaagcctgagaacctgcttcttgaccacaacatgcacgtgaaaatcgccgattttggt
ttgtccaacatgatgatggacggggagtttttgcgcactagttgtggttcccccaattac
gcggcacccgaggtcatttccggcaaactttacgccgggcctgaggtcgatatctggtcc
tgtggggttattctttacgcccttctttgtgggactttaccgtttgatgatgagcacgtc
cccaccctcttcaggaaaattaaatcgggcatttttcctatccctgaatacctaaacaaa
tcggtggtcaacctactttgccaaatgttacaaatcgatcccatgaaacgagcatcaatt
gaagaaatcaaaaagcacgaatggttccaaaaagactgtcctgcttacttattcccatca
cctgtggaccaagactcgtcagtgatcgacacagacgccgtggctgaagtttgcgataag
tttggggtgcaggagaaggaagtccacaatgctctcctgagtggggacccccatgatcaa
cttgcaatcgcttaccaccttattatcgataacaggcgcatagcggatgaagccgcaaag
gcggaaattaaagatttttacatcgcggggagtcccccacctgttagtatgagcccgagc
ccaagtccttgcgactttggttctagtcctttgaagcctcatccggagagaattgcgccg
ttgcgggacagaatggcttcaaatcatgctgcttcaggggacaggggaagagttaagagg
gctaagtggcatttagggattcgctcacaaagtaagccccacgatattatgatggaggtt
tacagagcaatgaaagcgttggattatgaatggaaagtcatcaatccataccatgtaaga
gtgcgtcataagaatcccttgcatgagaggtttgtcatgatgtcgctccaactatatcag
gtggattacaagagctacctcttggactttaaaagtttggccaacgaggaagcggagtcg
aacacggcggcccccatcatggggtcactgcccacgccagtgcagtccggcgagagcact
ttgaacgcgaaacccaaagggcattacacaatggaattttttgaaatgtgtgccgcttta
attatacagttggctcgttaa

DBGET integrated database retrieval system