KEGG   Tribolium castaneum (red flour beetle): 663357Help
Entry
663357            CDS       T01046                                 

Gene name
Snf1a
Definition
SNF1A/AMP-activated protein kinase
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    663357 (Snf1a)
   04150 mTOR signaling pathway
    663357 (Snf1a)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    663357 (Snf1a)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     663357 (Snf1a)
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   663357 (Snf1a)
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    663357 (Snf1a)
  Mitophagy factors
   Other mitophagy factors
    663357 (Snf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BEETLEBASE: 
UniProt: 
Position
LG7
AA seq 526 aa AA seqDB search
MGDVTQGAQGQMKIGHYILGQTLGVGTFGKVKIGEHQITGHKVAVKILNRQKIKSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVSGGELFDYIVKHGKLQEHEARRF
FQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMMDGEFLRTSCGSPNY
AAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPIPEYLNK
SVVNLLCQMLQIDPMKRASIEEIKKHEWFQKDCPAYLFPSPVDQDSSVIDTDAVAEVCDK
FGVQEKEVHNALLSGDPHDQLAIAYHLIIDNRRIADEAAKAEIKDFYIAGSPPPVSMSPS
PSPCDFGSSPLKPHPERIAPLRDRMASNHAASGDRGRVKRAKWHLGIRSQSKPHDIMMEV
YRAMKALDYEWKVINPYHVRVRHKNPLHERFVMMSLQLYQVDYKSYLLDFKSLANEEAES
NTAAPIMGSLPTPVQSGESTLNAKPKGHYTMEFFEMCAALIIQLAR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgggggatgtgacccagggggcgcaaggccagatgaagatcggccactacatccttggc
cagactttgggtgtggggactttcggcaaagtcaaaatcggggaacaccaaatcacgggg
cacaaggtggcggtcaaaattctaaatcggcagaagatcaagagcctggacgttgtgggg
aagatcaggagggagattcagaacttgaagctgtttcggcacccgcatattatcaagctg
tatcaggtgatcagcacgccgactgatatttttatgatcatggagtacgtctcggggggc
gagttgttcgattacattgtgaagcacgggaagttgcaagaacatgaggcgaggcggttc
ttccagcagatcatttcgggggttgattactgccaccggcacatgattgtgcaccgagac
ctgaagcctgagaacctgcttcttgaccacaacatgcacgtgaaaatcgccgattttggt
ttgtccaacatgatgatggacggggagtttttgcgcactagttgtggttcccccaattac
gcggcacccgaggtcatttccggcaaactttacgccgggcctgaggtcgatatctggtcc
tgtggggttattctttacgcccttctttgtgggactttaccgtttgatgatgagcacgtc
cccaccctcttcaggaaaattaaatcgggcatttttcctatccctgaatacctaaacaaa
tcggtggtcaacctactttgccaaatgttacaaatcgatcccatgaaacgagcatcaatt
gaagaaatcaaaaagcacgaatggttccaaaaagactgtcctgcttacttattcccatca
cctgtggaccaagactcgtcagtgatcgacacagacgccgtggctgaagtttgcgataag
tttggggtgcaggagaaggaagtccacaatgctctcctgagtggggacccccatgatcaa
cttgcaatcgcttaccaccttattatcgataacaggcgcatagcggatgaagccgcaaag
gcggaaattaaagatttttacatcgcggggagtcccccacctgttagtatgagcccgagc
ccaagtccttgcgactttggttctagtcctttgaagcctcatccggagagaattgcgccg
ttgcgggacagaatggcttcaaatcatgctgcttcaggggacaggggaagagttaagagg
gctaagtggcatttagggattcgctcacaaagtaagccccacgatattatgatggaggtt
tacagagcaatgaaagcgttggattatgaatggaaagtcatcaatccataccatgtaaga
gtgcgtcataagaatcccttgcatgagaggtttgtcatgatgtcgctccaactatatcag
gtggattacaagagctacctcttggactttaaaagtttggccaacgaggaagcggagtcg
aacacggcggcccccatcatggggtcactgcccacgccagtgcagtccggcgagagcact
ttgaacgcgaaacccaaagggcattacacaatggaattttttgaaatgtgtgccgcttta
attatacagttggctcgttaa

DBGET integrated database retrieval system