KEGG   Tribolium castaneum (red flour beetle): 663614Help
Entry
663614            CDS       T01046                                 

Definition
MAGUK p55 subfamily member 5-A
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    663614
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 961 aa AA seqDB search
MTKLSQQLNQQTTSSEELNGFINNTPIYVTSLTATENINNNPTASSNSQSGGGGGGNVLS
NTISVVATKEVAPKSSLPNGHDIVANDVRVEVKDAPSPGLEVPHLGDRRASSPFQNGRTE
LLIGAEDNKFKTTAIVESNNNKLGVDAESRPRRRSGSSIVVLDGDLDPVKKPPDELDDNL
DYNMVMMLSGDTGPHREMAVDVPDTFIARNKTPPRYPPPKPILQVGHFEERAVDVNQERA
IDVPDNFIEREKAPPKFPAKSGVNGTAAKPVPPPRDHLKLEKDGRIVNRAPAPQLPATPA
PATPAQAEPTREQLDSIKKYQEQIRKRKEEEDRIAAQNDFLKRSLRGSRKLQALESRPQG
SVNDGFAVDEAQDSSRSTTPTLEKEVVHTVYGYGDLVASVQRLQLQLKKAGAGGGLGGLE
GRVAAVQSLLLSPQFGRALAVHNKVQTVRSRTTPRPAPIAQTALRDCLDALGNSQSAYAV
ELASLLTGYELEALMVAHDGVASTLPPDSTSPGAPPVEPPPALPERFHEENIKIIKIEKS
TEPLGATVRNEGDAVVIGRVVRGGAADKSGLLHEGDEILEVNGIEMRGKSVNAVCDILQG
MEGTLTFLIVPASQARSHSGRDSVLHVRAHFDYDPEEDMYIPCRELGISFQKGDVLHVIS
QDDPNWWQAYREGEEDQTLAGLVPSQSFQHYRESMRLAAEERMARPQRKSSTLLCGKTAK
RKKKKGAYAEGGYPIYANAVDEHDPEEILTYEEVSLYYPRANNKRPIVLIGPPNIGRHEL
RQRLMEDSERFAAAIPHTSRARKENEVDGQDYHFITRAQFEADILSRKFVEHGEYEKAYY
GTSLDAIRSVVNSGKICVLNLHPQSLKILRTSDLKPYVVFVAPPSLEKLRQKKIRNGEAY
KEEELKDIIEKAREMEDKYGHFFDMIIINNDTERAYHQLLSEINSLEREPQWVPAAWVKA
L
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactgtcgcaacagttgaaccaacagaccacatcgagcgaagaactgaacggc
ttcatcaacaacacgcccatctacgtaacgtctttaacagccaccgaaaatataaacaac
aaccccaccgcaagcagcaattcgcaaagcggcggcggcggcggcggcaacgtcctctcc
aacaccatctcggtggtggccaccaaggaagtggcccccaagtcatcgctgcccaacggc
cacgacatcgtggccaacgatgtgcgggtcgaagtgaaggacgcccccagtccgggcctg
gaagtgccccatttgggcgaccgcagggcctcttcgccctttcagaatggacgcacggag
ctgctgatcggcgccgaagacaataagttcaagaccacggccatcgtcgagagcaataac
aacaagttgggagtcgacgccgagagcaggccacggcgacgctccggctcgagcatcgtt
gtcctggacggtgacttggacccggtgaaaaagcccccggacgagctcgacgacaacctg
gactacaacatggtgatgatgctgtccggcgacaccggcccccatcgcgagatggccgtg
gacgtgcccgacacgttcatcgcgcggaacaaaacgcccccacgttaccctcctccgaag
cccatcctgcaggtaggccacttcgaggagcgtgccgttgacgtgaaccaagagcgcgcc
atcgacgttcccgataacttcatcgagcgcgaaaaggcacctccgaagtttccggcgaag
agtggggtcaacgggacggctgccaagccggtgccgcctccaagggatcatctcaagctg
gagaaggacgggaggattgtgaatagggcgccggcaccgcagcttcctgctactccggct
ccggcaacaccggctcaggctgagcctacgagggagcagctggatagtattaagaaatat
caggagcagatccgcaaaaggaaagaggaggaagatcggatcgctgctcagaatgatttt
cttaaaaggtcgctcaggggctcgaggaaactccaagcgttggagagtcggccgcagggg
agtgtcaacgacggcttcgccgtcgacgaggctcaggactcctccaggtccacgacgccg
acgctcgaaaaggaagtggtgcatacggtttacggctatggggacctggtggcgtccgtg
cagcgcctccagctgcagctgaagaaggccggcgccgggggcggtttggggggcctggag
ggccgcgtggccgccgtccagtccctcctcctgtcgcctcaattcggtcgtgctttggcc
gttcacaataaagtccaaacagtgcgttcacgaaccactccacgaccggctcccattgct
cagactgcccttagagactgtttagatgccttagggaactcgcaaagtgcttatgccgtg
gaattggccagccttctcacagggtacgaactggaagccctcatggtggcccacgacggt
gtggcgtccactttacccccagactcaacctcaccgggggctccacccgtcgaacctccg
ccagctcttcccgaacgcttccacgaggaaaacatcaaaattattaaaattgagaagagt
acggaaccgctgggggcgacggtgcgcaacgagggggatgctgtggtcatcgggagggtg
gtgaggggaggggcggccgacaaaagcggactgcttcatgaaggcgacgagattttggag
gtcaatggtattgagatgcgcggcaagagcgtgaacgccgtttgtgatatcctccaaggg
atggagggaactttgactttcctaatagtcccagcgtcacaagcgaggtcgcattccggg
agggattcggtcctccacgtgcgagctcacttcgattacgacccggaggaggacatgtac
atcccgtgtcgggagttggggatcagtttccagaaaggagacgtcctccacgttataagt
caagatgaccccaactggtggcaagcgtatagagagggcgaggaggaccagactttggcc
gggttggtgccttcgcagtcgttccaacactacagggagagtatgagactggcggctgaa
gaacgaatggccagacctcagaggaagtcgtccacgttattatgcggcaaaacggcgaaa
cggaagaagaaaaaaggggcttatgccgaagggggttatccgatctatgccaatgctgtg
gatgaacacgacccggaggaaattctcacttatgaggaagtttccttgtattatccgcga
gcgaataacaagcgaccgattgttttaattgggccaccgaacattgggaggcatgagctg
aggcagaggcttatggaggactcggagcgctttgcagctgccattccacacacttcccgc
gcccgtaaagagaacgaagtcgacggccaagactaccattttataacacgcgctcaattc
gaagccgatattttatcacgaaagtttgtggagcatggagagtacgagaaagcctactat
gggacctctcttgacgcgattcgatcagttgtcaactctgggaaaatatgtgtcttaaac
ctacatcctcaaagcttgaaaatacttagaacgtccgacttgaaaccgtacgtggtgttt
gtggcccctcccagcctggaaaagctgcgacagaagaaaattcggaacggagaagcgtac
aaggaagaggagctgaaggatataatcgaaaaggcgcgcgagatggaggacaaatacggc
cactttttcgacatgataataataaataacgacacggaacgggcctaccaccagttgctg
agcgagataaacagcctggagagggagccacagtgggtgccagcagcttgggtcaaagca
ctttag

DBGET integrated database retrieval system