KEGG   Tribolium castaneum (red flour beetle): 663675Help
Entry
663675            CDS       T01046                                 

Definition
myo inositol monophosphatase-like
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tca00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tca00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tca04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 323 aa AA seqDB search
MNLGGVIRLNKTGLCVISGAVLILFIYVFTTSSNNDPPSVKINLKQLLEVAIKAAENGGK
EVVANKDNLQVKSKGLTKEGMQDRVTTADYSSHCAIMKTLKHAYPTLHIISEEKKVQCDD
REIDYLGHVTIPKSLDDHLEEIRDISVWIDPLDATYEYTGKLYKYVTTMVCVAVKEEPVI
GVIHKPFNTESHTFWAWVGKAKSSNLKYARSKSENIKIIISMSHSGEIKKVLSEKMKNVD
IIEAAGAGYKALEVALGNVDAYLHTTAIKKWDICAGNAIIKAVGGKMTTKFNELIDYKDD
TSVKNEKGLVVTITNHDMFIGKF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttgggggtgttatccgactaaacaagacagggctgtgtgtaatatcgggagct
gtgctgatattgtttatttacgtgtttactacaagttcaaataatgatcctccaagcgtt
aagataaatttaaagcagctcttggaggtagcaattaaggcagcggaaaatgggggcaaa
gaagtggttgcgaacaaggacaatttacaagtaaaaagcaaagggttgacgaaagaagga
atgcaagatagggtcaccactgcagattattcgtcacactgtgctattatgaaaactttg
aaacatgcatatcccaccctgcatataatttcagaggagaaaaaggtccagtgtgacgac
agagaaatcgattacttgggacatgtaaccattcctaagagcttagatgaccatttggaa
gaaattagggatatttctgtatggattgatccactagatgcaacttatgaatacactgga
aaattgtacaagtatgtgactacaatggtttgcgttgctgtaaaagaagaacctgttatt
ggtgtcattcacaaaccttttaacactgaatctcacacattttgggcatgggttggcaaa
gcaaaatcttcaaacttaaaatatgcgaggagcaagagtgaaaatataaagattataatc
tcaatgtcgcacagcggtgaaataaagaaagttttgagtgaaaaaatgaaaaatgtggac
ataattgaagccgccggtgctggctataaagctttggaagttgccttgggcaatgtggac
gcttatttgcacacaactgccatcaagaagtgggatatttgtgcaggaaacgctataata
aaggcagtgggaggtaaaatgacaacgaaatttaacgaattaattgattataaagatgat
accagtgttaagaatgagaagggtttagtagtcactataaccaaccatgacatgttcatt
ggaaaattttaa

DBGET integrated database retrieval system