KEGG   Tribolium castaneum (red flour beetle): 663711Help
Entry
663711            CDS       T01046                                 

Definition
AGAP001116-PA-like
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tca00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tca00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:tca00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:tca04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 340 aa AA seqDB search
MLSVAVIGAGVIGLPTALAIQEELGPKAEVIIFTDKLSPHTTGDVSAGLWSPYLLQNTPV
QQLTKWSKATQDYILKLWKNGDAKTTGISLQLIMALSNKKDYKAPEWLKISLGHSEFTQD
RLKYYSQRYGEEFTGGYAFVGFIWEPVRFLPYLEKKFKDRGGQIRMGRVENFAELSHFDV
VVNCSGLGARSLVPDPGVRPIRGQIARVRAPWQKHTFMLDTEPGNYVISNEDCVIVGGTH
QEDDFNTGIYDNDRDHILTGCRKYLPSLAKAQVIRDQAGLRPGRDQVRLEIEERRIGEKV
MKIVHNYGHGGSGVTLSIGCALDAARLVKEAAGLAGQSKL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccgtcgctgtgataggagcgggagtgatcggcctccctacggctttagccatc
caagaagaattgggtccgaaagctgaagtcatcattttcaccgacaaattaagtccccac
acaacaggtgacgtttcagccggcttatggtcgccttacctcctccagaacactccagtc
cagcaactcacaaaatggtcaaaagccacacaggactacattttaaaattgtggaagaac
ggcgacgccaaaactactggaatctccctccagttaataatggcattatcgaataaaaag
gactacaaagcgcctgaatggctcaagatcagtctgggccacagcgagtttacgcaagac
cggctcaaatattacagccagagatatggcgaggagtttactggaggttacgctttcgtg
gggttcatctgggagccggtcaggttcctcccatatttggagaaaaagttcaaggaccgc
ggcggtcaaatcaggatggggagagtcgaaaatttcgccgaattgtcacattttgacgtg
gtggtgaactgctcggggctcggagcgcgctctctcgtccctgacccgggggttcgcccc
atcagggggcagatcgcccgagtccgggccccgtggcagaagcacacttttatgctcgat
acggagcctggcaactacgtaatctccaacgaggactgcgtcatcgtcggaggaacgcac
caggaggatgacttcaataccggcatctacgacaatgaccgggatcacatcctgaccggg
tgcaggaaatacctgccctcgcttgcgaaagctcaagtgattagagatcaggccggtctg
aggccgggccgtgatcaggtccgattggaaattgaggagcggagaattggggagaaggta
atgaaaattgtgcacaattatgggcatggagggagtggggttactctctcgattggatgt
gcactcgatgctgcgagacttgtcaaagaagctgcaggcttggctggacaaagcaagctc
tag

DBGET integrated database retrieval system