KEGG   Tribolium castaneum (red flour beetle): 663788Help
Entry
663788            CDS       T01046                                 

Definition
ubiquitin carboxyl-terminal hydrolase CYLD
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     663788
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C67
   663788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG5
AA seq 904 aa AA seqDB search
MNSSESPKMGTKDFKYGIFIQNDLMTEMKQGQNQRTALLGQIVKIEATLGGGKYAVRFLK
DAETWESTTFVCRQQSIVPVNEKLWQFLYAVTSPQERVKLAKDKERCDKLANITTDITIG
FKDTDGVQLGQIKFLGVVRGIGHCVGIKLHQKKKDNKCDGSCAGTQYFNCLPGYGVFTTI
DRIVIQNSPLITNKNSVKTRNSTDLDLYLEKNVSSFSKSNHEEIVTKFGEYPQENMPPKT
TTYLRNSLSLQNILDTECSSGNSNNDFDQNTIIQPDKSHLINEKKAKMKSEINLSDMIGN
SWHGATDAKELQKFSNLNQTLDRPEKNGQKNNRNKSANILSHFYDGTLPKRNKINQPSAK
FYDTTPPRIKNGCPTHQEDEKKINEKSEKASNIPDKPKYHNPKPGTTKDLTVGSLVEVSN
DVSEEPLYGVVKWMGAEEGSNFVLVGVELEEEHIDLPLTLTDGTHNGERFFKCAENRALF
VPLDQCHQDSRFQDGVPTPVHQAAEPNFQSMECPVIEGAVAPLCMPTEEDVEAVCGKFRG
IQGHHNSCYLDVTLFSMFTYTAVFDSLLFRPKGPKDIPDYNEVQRVLREEIVNPLRKNLF
VRADRVMNLRRLLDRLSSVSGLTSEEKDPEEFLNSLLAQILKAEPFLKLNSGQESFYYQL
FVEKDADLTLPTVQQLFEQSFLTSNIKLKEVPSCLIIQMPRFGKNYKMYPRILPSQLLDV
TDVIEGSPRQCIVCGKLAHWECRECFDDCSNAGLESTAFCSMCLEKAHRHERRSHHRPAV
KLDVCDDFSILEDHCRPPRLFMELFAVICIETSHYVAFVKCGVGHEAPWCFFDSMADRKG
EKNGYNIPEMVACPDISRWLSDERICRQLHEDFPQDRHLPEHARRLLCDAYICMYQSSDV
MMYR
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaactctagcgaatcaccgaaaatgggcaccaaagacttcaaatatggtatttttatt
cagaacgatctgatgaccgaaatgaaacaagggcaaaaccagcggacggccctcctcggt
cagatcgtcaagatcgaagcaacactcgggggcggtaaatacgcggtacgtttcctcaaa
gacgccgaaacgtgggaatccaccactttcgtgtgtcgtcaacaaagcatcgtacccgtc
aacgaaaaattatggcagtttttgtacgccgttacctccccccaagaaagggtcaagttg
gccaaagacaaggaacgttgcgacaaactcgcaaacatcacaactgacataacaatcggt
tttaaagacaccgatggggtgcagttgggacaaattaaattccttggagttgttcgcggg
atcgggcactgtgtcggaattaaactacaccaaaagaaaaaagacaacaaatgtgacggt
tcatgtgcagggacccagtatttcaattgtttgcccgggtatggggtatttacgacgatt
gatcgaattgtcattcaaaacagcccccttatcacgaataaaaatagcgtgaagactagg
aatagcacagatctagatctctatttagaaaagaacgtttcgagtttcagtaaatctaat
cacgaggaaatcgttacaaaattcggggagtacccccaggagaacatgcccccgaaaacg
acgacttacctgcgaaactcgctgtctttgcaaaatatcttggacacggagtgttcaagc
ggcaattccaacaacgattttgatcaaaacacgatcatacaaccggacaagtcgcactta
atcaacgaaaagaaagccaagatgaaatcagaaataaatctgagcgacatgattggcaat
tcgtggcacggggccaccgatgcgaaagagttacagaaattctctaacctgaatcaaact
ctggacagacctgaaaagaacggtcagaaaaacaatcggaacaaaagcgcaaacattttg
tcgcatttctacgacggtactttacccaaacgaaacaaaataaatcaaccgtcggcgaaa
ttctacgacactacgcctcctcgaatcaagaacgggtgcccgacgcaccaggaagacgag
aaaaaaattaacgaaaaaagtgaaaaggcgtccaacatccctgataaacccaagtaccat
aatcccaaaccaggaactaccaaagatttaaccgtcgggagtttagttgaggtctccaat
gacgttagtgaggagcccctttacggcgtcgttaagtggatgggggccgaagagggctcc
aattttgtgttggtaggggtggagttggaggaagaacacatcgacttacccctaactctc
accgacgggacgcataacggggagaggttcttcaaatgtgcagaaaacagggcccttttt
gtgccgcttgatcagtgccatcaggattccagatttcaggacggggttcccacgccggtg
caccaggccgccgaacccaacttccagtcgatggagtgccccgtgatcgagggtgccgtg
gcgcccctttgcatgcccactgaggaagacgtggaggccgtctgtggcaaattccggggc
attcaagggcaccacaattcctgctacctcgacgtcacccttttctcaatgtttacctac
acagcagtatttgacagtttgttgtttcggcccaaaggtccgaaagatatccccgattat
aacgaggtccaacgagtattacgtgaagaaatcgtaaatccgctccgaaaaaatttgttt
gttcgtgccgatcgcgtgatgaatttgagacgtttattagatcgattaagttcggtgtcc
ggtttaacgagcgaagagaaggatcctgaggagtttctcaattcgcttttggcgcagata
cttaaagccgagccgtttttgaagcttaactcgggtcaggagtcgttttattatcagttg
tttgtggagaaagacgccgatttaacgttacccacagtacaacaattattcgaacaaagc
tttctcacgagtaacattaaattgaaagaagttccctcttgtctcatcatacagatgccg
aggttcgggaagaactacaaaatgtatccgagaattctaccgtcacagcttctagacgtg
actgacgttattgaaggatctcctcgtcagtgtatcgtttgtggcaaactcgcccattgg
gagtgtcgtgagtgctttgatgattgtagcaacgccgggctggaaagtacggctttctgc
tctatgtgtctcgaaaaagcccacagacacgaacggaggtcacaccaccgccccgctgtg
aaactagatgtctgtgatgatttctcgatccttgaagatcactgtcgtcctcctcgactt
ttcatggaactatttgctgtgatttgtattgaaacttcccattatgtagctttcgtcaag
tgcggagttggccacgaggcgccgtggtgttttttcgattcgatggcggatcgtaaaggc
gagaaaaatgggtacaatatcccggagatggtcgcatgtccggatatttcacgatggttg
tcggacgaacggatctgccgccagttacacgaggacttcccccaagaccgtcacctaccc
gaacacgcgcgcaggttgttatgtgatgcttatatttgcatgtaccaaagttctgacgtc
atgatgtacagatag

DBGET integrated database retrieval system