KEGG   Tribolium castaneum (red flour beetle): 663824Help
Entry
663824            CDS       T01046                                 

Gene name
USP7
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    663824 (USP7)
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     663824 (USP7)
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   663824 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG8
AA seq 1176 aa AA seqDB search
MVQIVGGRGLFIDLRASLIENTALAACLWRNSTPPKKQPSDKDLLNSNKKNKGVFGFAKD
RGAVKTPALNMNHVTGQYRRNDDTSAEVEEMETQEVTTTDSTDTGGGEMDQQNGEVIIGP
QPDPGMTVQDADMEEDESRSEATFRYTVQQFSKLKDSALSPACYVRNLPWKIMVMPRNSH
GQDRTAQRSLGFFLQCNGESESSSWSCYAVAELRLLSVRPDVEPFSRKIQHLFYSKENDW
GFSHFMAWNEVLDPEKGYIKDDAITLEVHVVADAPHGVSWDSKKHTGYVGLKNQGATCYM
NSLLQTLYFTNQLRKAVYKMPTESDDSTKSVALALQRVFHELQFCDKPVGTKKLTKSFGW
ETLDSFMQHDVQEFLRVLLDKLESKMKGTCVEGTVPKLFEGKMISYIRCKNVDYSSTRSE
TFYDIQLNIKGKKNIDESFKDYIAKETLDGDNKYDAGEHGLQDAEKGVIFSAFPPVLHLH
LMRFQYDPVTDCSVKFNDRFEFYEKISLDAYLQEPDPNNPANYTLHAVLVHSGDNHGGHY
VVFINPRGDGKWCKFDDDVVSKCTKQEAIEHNYGGHDEDMNMTVKHCTNAYMLVYIRDSE
LHNVLQEVTDADIPSELADRLAEEKRMEQVRRKERNEAHLYMTINVLLEDSFDGHQGNDL
YDPDRPLFRVFKIKKMALVSEMMDMFADAFKYPTEQIRPWPFSQRSNQTMRPCMLDLDTE
SHKAIIDSAENQNPWTIFLELLPPDSGLTALPNFDKETDVLLFFKMYDPKQKKIHYCGHS
YLPVTSKLGDLIPMLNERAGFPPDTELVLYEEIRPNMIEKITNYSDPLEKVLDELMDGDI
ILFEKEEREEFSDLPTCIDYFKDLYYRVEVTFVDKCTPNDPGFTMELSQRMTYDQLARAV
AQRVGTDPYLLQFFKCQNYKDSPGHPLRCTFEGTLKDLLVFSKPKAPKKIFYQQLSIRVN
ELENKKQFKCLYVGPNVFEEKELILYPNKRGTVSDLLEEAKKQIEFGEGSTGKLRFTEVS
CNKVALGPKEDTPLDHLVINAAKVYRIEQVPRDELHINEDEMLISCAHFQKEVFSTFGSP
FLFKIKQGEPFTKVKERIQKRLGVPDKEFEKYKFSIVAMGRQQVLQDDEYVVNLADFRPL
PNQAGSPKPWLGLDHMNKAPKRSRFNYLEKAIKIYN
NT seq 3531 nt NT seq  +upstreamnt  +downstreamnt
atggttcagatagtgggcgggcgtggtttatttatcgatctccgagcgtccctcattgag
aatacggcccttgctgcgtgcctctggcgaaatagcacaccaccgaaaaaacaaccgtcg
gacaaagaccttttgaatagcaacaaaaagaacaaaggtgtgttcgggttcgcgaaagac
agaggggctgtcaagacgccagcgctcaatatgaaccacgttacgggccagtacagacgc
aacgacgacacttccgccgaagtggaggagatggaaacacaggaagtcaccaccaccgat
tctacggacactgggggcggtgaaatggaccaacagaacggcgaagtcatcatcgggcca
cagcccgaccctggaatgacagttcaagacgcagacatggaagaggacgaatcgcgttca
gaagccacctttcgctacactgtccaacagtttagcaaactgaaagactctgctctgtct
ccggcatgttacgtacgtaacctcccttggaaaatcatggttatgccccggaacagtcat
ggacaggatcggactgcacagcgctctttgggctttttccttcagtgtaacggcgaaagc
gagtcctcttcgtggtcttgctatgccgttgctgagctgagactgctctcagttcgacca
gatgttgagcctttctcgcgaaaaattcaacatttgttctattcgaaggaaaatgattgg
ggattttcacattttatggcgtggaatgaggtcttagacccggagaaaggctatattaaa
gatgacgcgattactttggaagtacatgtggtggctgatgccccacatggagtctcatgg
gacagtaaaaaacatacaggttacgtgggtttaaaaaatcaaggagcgacctgttacatg
aactcacttcttcaaactttatattttacaaatcagttacgaaaagccgtttataaaatg
ccaaccgaatcagatgattcgactaaatctgtagcacttgctctacagcgagtctttcac
gaactacaattctgcgataaaccagtaggtacgaagaaattgacgaaaagtttcggttgg
gaaacgttagattcatttatgcaacatgatgtgcaggaatttctcagggtacttttagat
aaacttgaaagtaagatgaagggaacttgtgtggagggcaccgttccgaaacttttcgaa
ggtaaaatgatttcgtacattcggtgtaagaacgtggattattcgagcacacgttcggag
acgttctatgatattcagttgaatattaaggggaagaaaaatatcgatgagtcgtttaag
gattacatcgcaaaggagactctagatggcgataataaatacgacgcaggtgaacatggg
ttgcaagatgctgaaaaaggggtgattttttcggcttttcctcctgttttgcacttgcat
ttgatgcggtttcaatacgatcccgtcactgactgttccgttaaattcaatgatcgtttt
gaattttacgaaaagatttcgttagatgcttatttgcaagaaccggatcctaacaatccg
gccaactatactctacatgcagttctagtacattcaggcgacaatcacggtggtcattat
gttgtttttataaatcctagaggtgatggcaagtggtgtaaatttgacgatgatgttgtc
tccaaatgtacgaaacaagaagcaatcgaacataactacggcggacatgatgaggatatg
aacatgacagtgaaacattgtacaaatgcgtacatgttggtatacatcagagattcagag
ttgcataacgtattacaagaagtaaccgatgctgatataccaagtgaattagctgatcgt
ttggctgaagaaaaacgaatggaacaagtgagacgaaaagaacgcaacgaagcccatctc
tatatgactatcaatgttttgcttgaagatagttttgatggacatcagggtaatgattta
tacgatcctgatcgtccactatttcgtgtttttaaaatcaaaaagatggcactagtgagc
gaaatgatggatatgttcgccgatgcgtttaaatatccaactgaacaaataagaccatgg
ccatttagtcaacgatcaaatcagacaatgaggccttgtatgttagatctagacactgag
tcgcataaagctattatagattcagctgaaaaccagaatccttggactatatttctcgag
ttgttgccacctgattcgggcttaactgcgttaccaaattttgacaaagagaccgatgtt
ttgttgtttttcaaaatgtatgatccgaaacagaagaaaatacattattgtggacatagt
tacttaccggttactagtaaattaggagatttgataccgatgttgaatgagagggcaggg
tttccgccggatacggagttggtcttgtatgaggagattaggcctaatatgattgagaaa
attactaattatagtgatccgttggaaaaggttttggacgagttgatggatggcgatata
atcctgttcgagaaagaagaacgtgaggagttttctgacttgccaacctgtatcgactac
ttcaaagacctatattatcgtgtcgaggtaacatttgtcgacaaatgtacaccgaacgat
cccggttttacaatggaattatctcaaagaatgacttatgatcagttggcacgtgctgta
gctcagagggtcggtaccgatccttacttattacaattttttaaatgtcaaaattacaaa
gatagtcctggacatcctttaaggtgcacttttgagggcaccttgaaagatctcttagtt
ttttccaagccaaaggcgcctaagaaaatcttttatcaacagttgagtattcgtgttaac
gaattagaaaataaaaaacaatttaaatgtctttatgtgggaccgaatgtgtttgaagag
aaggagttaattttgtatccgaataagagagggacggtaagtgatttgttggaagaggcg
aagaaacaaatcgagtttggtgaaggaagtacagggaaattaaggtttaccgaagttagt
tgtaataaagtagcactgggtcccaaagaagatacgccgctagatcatttggtaataaat
gcagcaaaggtttatagaattgaacaagtgccaagagatgagttgcacataaacgaggac
gaaatgcttatttcttgtgcgcattttcaaaaggaagttttttcgacttttggctcccct
ttcttatttaaaattaaacaaggggagccttttaccaaggtcaaagaacgtattcaaaag
cgacttggtgttcctgataaggaattcgaaaagtacaagttttctatcgttgctatgggc
cgacaacaggtccttcaagacgacgaatatgtagttaatttagccgattttagaccactt
ccgaatcaagctgggagtcccaaaccatggttgggcctggatcatatgaacaaggccccg
aaaagatcacgttttaattatttagaaaaagccatcaaaatttacaattga

DBGET integrated database retrieval system