KEGG   Tribolium castaneum (red flour beetle): 663836Help
Entry
663836            CDS       T01046                                 

Gene name
bsk
Definition
basket
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    663836 (bsk)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    663836 (bsk)
   04391 Hippo signaling pathway -fly
    663836 (bsk)
   04068 FoxO signaling pathway
    663836 (bsk)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     663836 (bsk)
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   663836 (bsk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG8
AA seq 412 aa AA seqDB search
MDRSCRLFFQTTASNYWDWRYKMSRLSQFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVC
AAVDTETQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRSLEDF
QDVYLVMELMDANLCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKS
DCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRG
GVLFPGTDHIDQWNKIIEQLGTPSQQFMMRLQPTVRNYVENRPRFTGFPFDKLFPDVLFP
SDSSEHNRLKASQARDLLSRMLVIDPERRISVDDALLHPYINVWYDELEVNAPAPGPYDH
SVDEREHTVEQWKELIYQEVMEYESSRGRGASSSQPSPASNSIEPNGTDSMR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttcttgcaggttatttttccagacgacggcgtcgaactattgggactggcgc
tataaaatgtcccgtctgtctcaattctacaccgttgaggtgggcgacaccaaattcacc
attctgaagaggtaccaaaatctgaaaccgatcggctcaggagcacaaggaatcgtctgc
gccgctgttgatactgaaacacaacaaaatgtagcgattaagaaattgagtaggcccttt
caaaatgtgacgcacgctaaaagggcgtatcgcgaattcaagctcatgaaattagttaat
cataaaaatattatcggacttttgaacgctttcacgcctcaaaggtccttagaagacttc
caagatgtttatttagtgatggaattaatggacgcgaatctatgtcaagtcatacaaatg
gatttagatcatgaaaggatgagttatctcctttatcaaatgctttgcggtattaaacat
ttacattcagctggtattatacatagggatctcaaaccaagcaatattgtagttaaatca
gattgtacattgaaaattttagactttggtcttgcacgtactgctggtactacttttatg
atgactccatacgtggtcactagatattacagagcgccagaagttatcttaggtatggga
tatacggaaaatgtggacatttggagcgtcggatgtatcatgggtgagatgataagagga
ggagtcttatttcctggtactgatcacatagaccaatggaataaaatcatagaacaactg
ggtacaccatcgcaacaattcatgatgcgtttgcaaccaactgttcgcaactacgtcgaa
aatcggccccgtttcacgggcttccccttcgacaagctcttccccgatgtgctgtttccc
tccgacagcagcgaacacaatcgactgaaagcgagtcaagcgagagatttactatccagg
atgcttgtaatcgatccagaacgcaggatatcggtcgacgatgcacttcttcatccatac
atcaacgtctggtatgacgaactagaagtgaatgcgcccgcaccaggaccctacgatcat
agtgtcgatgaaagagaacacactgtcgaacaatggaaggaacttatctaccaagaagtt
atggaatatgaaagttcgcgcggaagaggcgcctccagttcacaaccgagtcccgcatct
aattctattgagccaaatgggacggattcaatgcggtag

DBGET integrated database retrieval system