KEGG   Tribolium castaneum (red flour beetle): 663929Help
Entry
663929            CDS       T01046                                 

Definition
alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    663929
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     663929
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   663929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG4
AA seq 545 aa AA seqDB search
MFVAITVLCLLVPSQLAAVIKNENLFQYINPTPDNELLREDKQFWYDVGNNYLEKNLRYD
HESTTKVAKNVVILIGDGMGISTITATRIYKGQRSGKSGEDHTLAYDNFPNVALVKTYNV
DMQVPDSAGTATALFTGVKTRYEAVGVDVNCNKTIADRTVFEASKLEGIMTWAQQANKST
GIVTTTRITHATPASTYAHAHYREWECDSEMPQEFKPFVKDIARQLVEDAPGNNFKVILG
GGYQQMGHIFEDLSDGECVRNDTLNLTQTWIDDHKGLKASFVTNNQQLENVGDVDYLLGL
FYPDHLPYELLRNKGLDGTPSLSQMTKKGLDILQKNPNGFVLMVEGGRIDHGHHDNYARL
ALEEASEFEKTVALIVETCGPETLILVTADHSHAMTLNGYSRRGNDILGYGLETEDDKPA
LTLTYANGPGFAYHFSPNVSTVLGPWRDVREDWNRLNNPKYQQMASFELDDETHGGEDVA
IFGTGPGSHLVRGVVEQNYVAHLISYAACIGPRAGINPRCAKNLDVSLVGNFYLLFSMLF
FLNKL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtcgcaattacggttttgtgtcttttagttccttcacaattggctgcagtgata
aaaaatgaaaatctgttccagtacataaatcctactcctgataacgagctacttcgtgaa
gataaacagttctggtacgatgttggtaacaactatttggaaaaaaacttaagatatgac
cacgaaagcaccacgaaagtggccaaaaacgtcgttattttaatcggggatgggatgggg
attagcaccatcacagccacacggatctataagggccaaagaagtgggaaaagcggtgaa
gatcacacgcttgcctacgacaactttcccaatgttgccctagttaagacttataatgtg
gatatgcaagtgccagattctgccggaactgccactgctctcttcacaggtgttaaaacc
cgatatgaagcggtcggtgttgatgttaattgcaataaaactattgccgatcggaccgtt
tttgaggccagcaaacttgagggtatcatgacttgggcgcaacaagccaacaaaagcact
ggcattgttaccaccaccagaataacacacgctactcctgcctcaacttacgcccatgcc
cattatcgggaatgggagtgtgacagcgaaatgccccaagagttcaaaccttttgtcaaa
gacatcgccagacaactggtggaggacgcccctggtaacaatttcaaggtcatactcggg
ggaggttaccagcaaatgggccacattttcgaagatctgagcgacggtgaatgcgtcaga
aatgatactttgaatctcacgcaaacatggattgatgatcacaaagggcttaaggcttcg
tttgtgacaaataaccaacaactggagaatgtgggtgatgtggattatcttttggggctt
ttttaccccgaccatctcccgtacgaattgttgcgtaacaaagggctcgacggaaccccg
agtctctcccaaatgaccaaaaaaggtctagatattttgcaaaagaaccccaatgggttt
gtcctaatggttgaaggcggtcgtatcgaccacggccaccacgacaattacgcccgacta
gcactggaggaagcatcagagtttgagaaaactgtggccctaattgtggaaacctgcggc
cctgagactctaattctggtgaccgcggaccattcgcacgccatgacactgaacggttac
agccggcgcggaaatgacattttaggatatgggcttgagacggaagatgacaaaccggcc
ctcactttaacctacgccaacgggccgggattcgcctaccacttttcccccaacgtttcg
acggttttgggcccttggcgtgatgtcagagaggattggaaccgtctgaataacccgaaa
tatcaacagatggcgagttttgagctcgatgatgagacgcatgggggcgaagatgttgct
atttttgggacagggcccggctcgcatcttgtccggggagtggttgagcaaaactatgtc
gcacatttgatcagctatgcggcttgtatcgggcctagggccggaattaacccgcggtgt
gcgaaaaatctggacgtttcacttgtcggcaatttttatttactgttttcgatgctgttt
ttcttaaataaattataa

DBGET integrated database retrieval system