KEGG   Tribolium castaneum (red flour beetle): 663933Help
Entry
663933            CDS       T01046                                 

Definition
similar to CG8445-PA, isoform A
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     663933
Peptidases [BR:tca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   663933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 407 aa AA seqDB search
MPVDIKELTEGWLELESDPGLFSLLLEDFGVKGVQVEEIYDIHKPLDGPVYGFIFLFRWM
EERRSRRKIVEQTEVFVRDEEIVNDIFFAQQMVPNSCATHALVSVLLNCADLHLGATLER
LRTHTRGMSPENKGWAIGNTPELAKAHNSHAMPQAKRRLDKSSGVSTGRFTGEAFHFVSF
VPINGRLFELDGLKPWPIDHGPWNEGDQWTDKFRAVIADRLAISAGDEGSEIRFNLMAVV
PDRRLAIHHKLKMLKTNRQIVLDALKHLVKVKKDKKEETASNNAMEEDPPQGILEPHTFA
PQDLLALLRNLENEICMCEINLKDENDKQNKYKIDDCRRTHNYDEFICTFLSMLAEQGKL
ADLVEQHLQVPKRPGTVPQPKAAKTAKKHETGATKRKKGRTKVKRRR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggacataaaggaattaaccgaaggctggctggagttggaaagcgacccaggc
ctgttctcccttctcttggaagacttcggcgtaaaaggcgtccaagttgaagaaatctac
gacatccacaagcccttagatggccccgtttacggtttcattttcctgttccgctggatg
gaggagcggcgctcgcggcgaaaaatcgtggagcaaaccgaagtgtttgttagagatgag
gaaatcgtaaacgacatatttttcgcgcagcaaatggtccccaacagttgcgcgacccac
gctctggtttcagtattgctaaactgtgccgacttgcacttgggggcgactttagagcgg
ctacggacgcacactagaggcatgtcgcctgagaataaaggctgggcgattgggaacacc
ccagagctggccaaagcgcacaactcgcacgcgatgccgcaagccaagagacggctagat
aagagtagcggggtttcaactgggcggtttacaggagaggcgtttcatttcgttagtttt
gttccgataaacgggcgtctgtttgaactggatgggctgaagccgtggcccatcgaccac
gggccgtggaacgagggtgaccaatggacggataaattccgggctgttatcgccgataga
ctggcgataagtgcgggagatgaaggaagcgaaatccggtttaatctaatggcggtggtg
ccggaccgccgacttgcaattcaccacaagttaaaaatgttgaaaacgaacagacagata
gttctggacgcgttaaaacatctagtcaaagttaaaaaagacaaaaaagaagagactgca
agtaacaatgcaatggaggaagatccccctcaagggattttggagcctcacacttttgcc
ccacaagaccttttagcgcttttgcggaatttagaaaacgagatttgtatgtgtgagatt
aatttaaaagatgaaaatgataagcagaataaatataagattgatgactgcaggaggact
cataattatgacgaatttatttgtacgtttttatcaatgttagcggagcaaggaaaattg
gctgatttagttgaacaacatttgcaagttcctaaaaggcctgggactgtgccccaacct
aaagctgcgaaaacggccaagaaacatgaaactggtgcgacgaaaaggaagaaggggagg
acgaaagtaaagagaagaaggtga

DBGET integrated database retrieval system