KEGG   Tribolium castaneum (red flour beetle): 663941Help
Entry
663941            CDS       T01046                                 

Gene name
Tiap1
Definition
(RefSeq) inhibitor of apoptosis 1
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    663941 (Tiap1)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    663941 (Tiap1)
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    663941 (Tiap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
LG2
AA seq 345 aa AA seqDB search
MNVFKKAMVDTLSSNSTILRSMKDSSHIINYEPYKPLPPETKASVTEPDNGHKSEALSAS
ARLDLTKEADRLSTFIDWKSSAVTPEALAKAGFYFLNNPSKPDLVKCAFCKAEICSWEQD
DEPLSEHVRWSPNCPFAKEKSQNLRVPAQGQDVCGNVELFPNSVPESETFRMLRTMIRPY
EDKKARLESFATWPSSAKQSPETLADAGFYYRGVEDHTICFSCGGALRDWKDEDEPWEEH
AKWYPRCEFLVASKGQGYINQVQKKMAGVSASNVTKENESTEEKSECGAASEDGVILCRI
CDRFERNTVFMPCKHIIACTQCSDVMQNCPICRKGIDSKIKVYIS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttttaagaaagcaatggttgacacactctcgagcaactccaccattctgcgc
tctatgaaagacagcagtcatatcatcaactatgagccctacaagccgcttccccccgag
acgaaagcaagtgtcaccgagccggacaacggccacaaaagcgaagccctgagcgcctcc
gcccgactagacctaactaaggaggcggatcgcttgagcacattcatagactggaaaagt
tcggctgtaactcccgaagccttagccaaagccggcttctacttcttaaacaacccctcg
aagcccgaccttgtgaagtgtgccttttgcaaagcggaaatctgcagttgggagcaggac
gacgagccgctgtccgagcacgtgcgatggtcgccaaactgcccctttgccaaagagaag
agccagaacttgcgcgtcccggcccaaggccaggacgtgtgcgggaatgtggagctgttc
ccgaactcggttccggagagtgagacgttccggatgctccggacgatgatccggccgtat
gaagacaagaaggcgcggttagagtcgtttgcgacttggccgagttccgcgaagcaaagt
ccggagacgctggctgatgccgggttttactaccggggggtggaggaccacactatttgt
ttttcgtgtggaggggcgcttagggactggaaggacgaagacgagccgtgggaggagcac
gcaaagtggtatcccaggtgtgagtttcttgtagcttccaaaggacagggttatattaac
caagttcagaaaaaaatggccggtgtgtcggcgagtaatgtaaccaaagagaacgaaagt
actgaggaaaaaagtgagtgtggtgcagcgtctgaagatggagtgattttatgcagaatt
tgcgacagatttgaaagaaataccgtttttatgccgtgtaaacacattattgcgtgtacg
caatgttcggatgttatgcaaaattgtccaatttgtagaaaaggcatcgacagcaagatt
aaagtgtatatatcttaa

DBGET integrated database retrieval system