KEGG   Tribolium castaneum (red flour beetle): 663941Help
Entry
663941            CDS       T01046                                 

Gene name
Tiap1
Definition
inhibitor of apoptosis 1
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    663941 (Tiap1)
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    663941 (Tiap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 338 aa AA seqDB search
MVDTLSSNSTILRSMKDSSHIINYEPYKPLPPETKASVTEPDNGHKSEALSASARLDLTK
EADRLSTFIDWKSSAVTPEALAKAGFYFLNNPSKPDLVKCAFCKAEICSWEQDDEPLSEH
VRWSPNCPFAKEKSQNLRVPAQGQDVCGNVELFPNSVPESETFRMLRTMIRPYEDKKARL
ESFATWPSSAKQSPETLADAGFYYRGVEDHTICFSCGGALRDWKDEDEPWEEHAKWYPRC
EFLVASKGQGYINQVQKKMAGVSASNVTKENESTEEKSECGAASEDGVILCRICDRFERN
TVFMPCKHIIACTQCSDVMQNCPICRKGIDSKIKVYIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggttgacacactctcgagcaactccaccattctgcgctctatgaaagacagcagtcat
atcatcaactatgagccctacaagccgcttccccccgagacgaaagcaagtgtcaccgag
ccggacaacggccacaaaagcgaagccctgagcgcctccgcccgactagacctaactaag
gaggcggatcgcttgagcacattcatagactggaaaagttcggctgtaactcccgaagcc
ttagccaaagccggcttctacttcttaaacaacccctcgaagcccgaccttgtgaagtgt
gccttttgcaaagcggaaatctgcagttgggagcaggacgacgagccgctgtccgagcac
gtgcgatggtcgccaaactgcccctttgccaaagagaagagccagaacttgcgcgtcccg
gcccaaggccaggacgtgtgcgggaatgtggagctgttcccgaactcggttccggagagt
gagacgttccggatgctccggacgatgatccggccgtatgaagacaagaaggcgcggtta
gagtcgtttgcgacttggccgagttccgcgaagcaaagtccggagacgctggctgatgcc
gggttttactaccggggggtggaggaccacactatttgtttttcgtgtggaggggcgctt
agggactggaaggacgaagacgagccgtgggaggagcacgcaaagtggtatcccaggtgt
gagtttcttgtagcttccaaaggacagggttatattaaccaagttcagaaaaaaatggcc
ggtgtgtcggcgagtaatgtaaccaaagagaacgaaagtactgaggaaaaaagtgagtgt
ggtgcagcgtctgaagatggagtgattttatgcagaatttgcgacagatttgaaagaaat
accgtttttatgccgtgtaaacacattattgcgtgtacgcaatgttcggatgttatgcaa
aattgtccaatttgtagaaaaggcatcgacagcaagattaaagtgtatatatcttaa

DBGET integrated database retrieval system