KEGG   Tribolium castaneum (red flour beetle): 663948Help
Entry
663948            CDS       T01046                                 

Definition
AGAP004654-PA-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    663948
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     663948
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    663948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 306 aa AA seqDB search
MAQSAPLILRLLASSVTAANRAGKIIRDIMARGDLGIVDKGINDLQTEADRSAQRCIVAS
LSQQYPDLTIIGEEGANNSEVPSDWIVTDYDKVVISKQCPPEYSTVTSEDIVVWVDPLDG
TSEYTQGLLEHVTVLVGLSVKGKAIAGVIHQPYYNYKSGNSIGRTIWGLVGMGVGGFDPQ
GAPPGKLILTTTRSHSDGTVQKALEALNPDEIIKVGGAGHKVLLLIEGKAHAYVFASKGC
KKWDTCAPEAVLVATGGKLTDMHGNAYNYGKDVQHPNTGGVFATVSGLDHEGLLAKIPQE
VKDKLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagcgctcctctaattttgcgtttactggcatcttccgtaaccgcggccaat
agggcgggaaaaataatacgggatataatggccaggggagacttggggattgtcgataag
ggcattaatgatcttcaaactgaagcagacagatctgcacaacgctgtatcgtggcttct
ttatctcagcaatatccagatttgaccataattggggaagaaggagcaaataattctgaa
gtgccaagcgactggattgtaacagactatgacaaagtggtaatctcaaaacagtgcccc
ccggaatattccaccgtaacaagtgaggatattgtggtctgggtggacccccttgatggc
acatcagagtacacccaggggctcttggaacatgtcacagtattagtaggtttgtcggtg
aaaggcaaagccatagctggtgtcatacaccagccctactacaattacaaaagcggcaac
tcaatagggcgcacaatttgggggctcgtgggcatgggggtcgggggctttgacccccaa
ggggcgccccctggcaaacttattctcactacgaccaggtcacactctgatggtacagtc
cagaaagccctcgaggctctaaatccagacgaaattatcaaagttggaggtgcaggccat
aaagtgttgttactgatcgagggcaaagcccacgcgtatgtctttgcaagcaaaggctgc
aaaaaatgggacacttgcgcccccgaagcagtgctagtggctactgggggtaaactaaca
gatatgcacgggaacgcttataactatggcaaagatgttcagcaccctaacacagggggg
gtgtttgcgaccgtgagtggtttggaccatgaaggtttgttagcgaaaattccacaagaa
gttaaagacaaactcaagtga

DBGET integrated database retrieval system