KEGG   Tribolium castaneum (red flour beetle): 663954Help
Entry
663954            CDS       T01046                                 

Definition
alpha amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    663954
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     663954
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 490 aa AA seqDB search
MHFKPILVLCLATLALGQKDPHFAADRNSIVHLFEWKWSDIADECERFLAPKGFGGVQIS
PPNENLVVTSSNRPWWERYQPVSYILNTRSGDEAALADMISRCNAVGVRIYVDTVINHMT
GMGGTGTAGSQADRDGKNYPAVPYGSGDFHDSCTVNNYQDASNVRNCELVGLADLNQGSD
YVRSKIIEYMNHLVDLGVAGFRVDAAKHMWPADLEAIYASLKNLNTDHGFLDGQKPFIFQ
EVIDLGGEAISKHEYTGFGTVIEFQYGLSLGNAFQGGNQLANLANWGPEWNLLDGLDAVA
FIDNHDNQRTGGSQILTYKNPKPYKMAIAFMLAHPYGTTRLMSSFAFDNNDQGPPQDGAG
NLISPSINDDGTCGNGYVCEHRWRQIFNMVGFRNAVQGTGIENWWSDGNQQIAFGRGNKG
FVAFTIGYDLNQHLQTGLPAGSYCDVISGNAENGSCSGKTITVGGDGYADLSLGANEDDG
VIAIHVNAKL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcaaacccatcctcgtcctgtgtttagcaactttggctttgggccaaaaagac
ccacactttgccgctgacagaaactcaatcgtgcatttattcgaatggaaatggtcagac
atcgctgacgagtgcgagcgattcttggcaccgaaaggcttcggcggagttcaaatttca
ccacctaacgaaaatttggtcgtaacaagcagtaacagaccatggtgggagaggtaccaa
ccggtgagttacatcctcaatacgcgatcaggggacgaagcggctttggctgacatgatc
agtcgatgcaatgccgttggagtcaggatttatgtagatactgtcatcaaccacatgact
gggatgggcggtactgggaccgctggctcacaggcggaccgtgatgggaaaaattatccg
gcagtaccatatgggtctggagattttcacgactcttgcactgttaataattaccaagat
gccagcaatgtgcggaattgtgaacttgtgggacttgctgatttgaatcaaggttcggat
tacgtccgaagcaagattattgaatacatgaaccacttggtcgacctgggggttgcaggg
ttccgagtggatgcagcaaaacacatgtggccggccgacctagaggcaatttacgccagt
ttgaagaatttaaacactgatcatggttttctcgacggccagaaaccgttcatctttcag
gaagtcatagatttgggtggtgaagcaatcagcaaacatgaatataccggcttcggtact
gtcatagaattccaatatgggctaagtctaggtaacgctttccaagggggcaaccaactg
gccaatttggccaactggggcccggagtggaacctgcttgatggtctcgacgccgttgct
ttcatcgacaaccacgacaaccaaagaacagggggctcccagatcctcacgtacaaaaac
ccaaaaccgtacaaaatggccattgctttcatgctagcgcacccatatggtaccacccga
ctgatgtcgagcttcgcctttgataacaacgaccaagggccgccgcaagacggtgctggt
aatttgataagcccgagtatcaatgacgatggtacttgtggtaatgggtacgtgtgcgag
caccgatggcgccagattttcaacatggttgggttcagaaacgccgttcaaggaacggga
attgagaactggtggtcggatggtaaccagcagatcgccttcgggagaggaaacaaagga
tttgtcgccttcaccattgggtacgacctcaaccagcatttgcaaacaggactgccggct
gggtcgtactgtgacgtgataagtggtaacgcggaaaatgggtcttgttcggggaaaacc
atcacggttggaggagatggatatgccgatctttccctcggagctaatgaagatgacgga
gtgattgccattcatgttaatgccaaattgtaa

DBGET integrated database retrieval system