KEGG   Tribolium castaneum (red flour beetle): 663975Help
Entry
663975            CDS       T01046                                 

Definition
similar to CG5072-PB, isoform B
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     663975
Protein kinases [BR:tca01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   663975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 322 aa AA seqDB search
MPPEKTLYDEMDSIGRGAYGIVYKGKHKTTGKIVALKKISVPLNDDGVPMNTLREIGVLK
QLNSHEHPNIVQLLDVCHGIQTERELLMYLVFEHVDQDLALYMEKYAKRGGFSSVQIRNM
SQEILRGVDFLHSNRIVHRDLKPQNLLVTNEGHIKIADFGLAKTYDFEMRLTSVVVTLWY
RAPEVLLGVPYATPVDVWSIGCIIAELFSLKPLFYGSSESDQLSKILRILGKPPQHEWPD
NSLSINWDSFDNTERIDFKEIIQNLGDSAHDLLTVSYCYFVYMFFMFLFYGQMLQKMLTF
DPKKRMSTLDALNHVYFTEEPI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcctccagaaaagaccctttacgatgaaatggacagtataggccgaggtgcttacggg
atcgtctacaaaggcaagcacaaaaccaccggcaagatcgtagccttgaaaaaaatcagc
gtgcctctgaacgacgatggggtccccatgaacaccctccgggaaatcggggtcctcaag
cagctcaactcacacgagcaccccaacattgtccagctcctggacgtctgccatggcatc
cagaccgagcgcgaattgttaatgtatttagtgttcgaacacgtggaccaggatctcgcc
ctctacatggaaaagtacgccaaacgtggtggcttctcctccgtacaaatccgtaacatg
tctcaggaaattctcagaggtgttgacttcttgcacagtaataggatagttcatagggac
ttaaagccgcaaaacttgttggtgaccaacgagggccacatcaagattgcggattttggc
ttggccaagacctacgattttgaaatgaggctgacctctgttgttgttacgttgtggtac
agagcgcctgaagtattgttaggagtgccgtatgcgacgcctgtggacgtgtggtccatc
ggatgcatcatagcggagctttttagtctaaaaccgctgttttatggcagttctgagagc
gatcagttgagcaaaattttgagaattttggggaagccgccgcagcacgagtggcctgat
aacagcctctccatcaattgggattcttttgataacaccgagaggatcgattttaaagaa
atcatccagaatttgggtgacagcgcacatgacttgcttacggtaagttattgttatttt
gtttatatgttttttatgtttctattttatggccaaatgttacagaaaatgcttactttt
gatcctaaaaaacgaatgagtaccttagatgccctcaatcatgtgtatttcactgaggaa
ccgatataa

DBGET integrated database retrieval system