KEGG   Tribolium castaneum (red flour beetle): 664074Help
Entry
664074            CDS       T01046                                 

Definition
enoyl-CoA delta isomerase 1, mitochondrial-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    664074
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     664074
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   664074
  Exosomal proteins of colorectal cancer cells
   664074
  Exosomal proteins of bladder cancer cells
   664074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 281 aa AA seqDB search
MALRNGVRRGGALISNYFRSYSSAGPLVNVAVNEKTGVATATLNRPPVNSMNLELLTEIS
NTLTQLEQNKCRGLILTSSSKSVFSAGLDILEMYKPDPSRLKEWWTALQQTWIKLYGSSY
PTVAVINGHAPAGGCLLSLSCEYRIMLNNFTIGLNETQLGIVAPQWFIASMRNVIGTRQT
ELALTSGNLFSTDEALKIGMIDEVAASKEDGIARAEKFCGRFARIPPIARARSKLGVRGA
DIQDLTNNLQKDYENVANYVAQDSVQKGLEMYLQSLKQKQK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagaaacggtgttcgtcgcggtggtgccttaatttctaattatttccgaagt
tactcaagcgctgggccccttgttaacgtcgccgttaacgaaaaaacaggggttgcgacg
gcaaccctcaaccgcccccctgtgaacagcatgaatttggagctccttactgaaatatca
aacactttgactcaactggaacagaacaagtgtagagggttaattttgacctcgagttcc
aagagtgtcttcagtgccggcttggacatccttgagatgtacaagccggaccccagccgc
ttgaaagaatggtggactgctttacagcaaacttggattaaactttacggttcttcgtac
cctactgtggcagttatcaatggccacgccccagctgggggctgtttgctgtccttgtcg
tgtgaatacagaataatgttgaacaatttcaccattggcttaaacgagacccaacttggg
attgtggccccacaatggttcattgcgtccatgaggaatgtgattgggacgagacagact
gaattggctttaactagcggcaatcttttctcaactgacgaagctttgaaaattggaatg
attgacgaggtggcggctagcaaagaggatggcattgcaagagcggagaagttttgcgga
agattcgccagaattccgccaattgcaagagccagatccaagttgggagtgcgaggcgct
gacatacaagacctcacaaacaatctccaaaaagattacgaaaatgtggcgaactacgta
gctcaggacagtgtgcaaaaggggttggaaatgtatctgcaatcattgaagcagaaacag
aaataa

DBGET integrated database retrieval system