KEGG   Tribolium castaneum (red flour beetle): 664074Help
Entry
664074            CDS       T01046                                 

Definition
similar to Protein disulfide-isomerase precursor (PDI)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    664074
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     664074
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   664074
  Exosomal proteins of colorectal cancer cells
   664074
  Exosomal proteins of bladder cancer cells
   664074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG3
AA seq 814 aa AA seqDB search
MNLLSAFCLIATAASLGWASEEIKSDEGVLVLTKSNFKQAITDNEFILVEFYAPWCGHCK
ALAPEYVKAAKALADQDSKIKLGKVDATEETELAEEHQVRGYPTLKFFRNGSPIDYNGGR
QADDIVAWLLKKTGPPAKEIKTVEEAKEFIDASNVAVIGFFKDQTTDKAKAFLAAAATID
DYPFGITSEDSVYKEYEAECGSIVLFKKFDEGKVLFEGEATEKNIKKFVAGNSLPLIVEF
NHETAQKIFGGDIKSHLLLFLNKGEDHFEKVSEAARAVAKPFKEQVLFVTIDAGEEDHQR
ILEFFGMKKEEVPAARLIKLEEDMAKYKPETDELSSESIKKFVEDFLAGKLKQHLLSQDL
PEDWDKEAVKVLVATNFDSVVFDADKDVLVEFYAPWCGHCKQLAPIYDKVGEHFKDDKSV
VVAKIDATANELEHTKITSFPTLKFYPKGGNNVIEYNGPRTFEGLVKFIESGGVDGAGVD
EPVEEETEDDDSPRKDELLCSHNQKLFFNLVVLLWCRYLIPFPDIVLILFPCKMALRNGV
RRGGALISNYFRSYSSAGPLVNVAVNEKTGVATATLNRPPVNSMNLELLTEISNTLTQLE
QNKCRGLILTSSSKSVFSAGLDILEMYKPDPSRLKEWWTALQQTWIKLYGSSYPTVAVIN
GHAPAGGCLLSLSCEYRIMLNNFTIGLNETQLGIVAPQWFIASMRNVIGTRQTELALTSG
NLFSTDEALKIGMIDEVAASKEDGIARAEKFCGRFARIPPIARARSKLGVRGADIQDLTN
NLQKDYENVANYVAQDSVQKGLEMYLQSLKQKQK
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttctttcggctttttgtttaattgcaacggctgcatctctgggctgggccagt
gaagaaattaagagcgacgaaggcgtcctagtgctcaccaaatccaacttcaaacaggcc
atcaccgacaacgaattcatccttgtagagttttatgccccatggtgtggacattgcaag
gcgttagcccccgaatatgtaaaggcagcgaaagcgctcgccgaccaagactctaaaatt
aaactcggcaaagttgacgccactgaagaaaccgaacttgctgaagaacaccaagttaga
ggttacccaaccttgaagttcttcagaaacggaagtcccattgactacaacggtggcaga
caagccgatgatattgtcgcctggcttttgaaaaaaactggaccaccagcgaaagaaatc
aaaactgtcgaagaagccaaggagtttattgatgccagcaatgttgctgttattggattt
ttcaaagatcagacgactgataaggcaaaggccttcctggcggcagccgccaccatcgac
gattatcccttcggaatcacctctgaagacagcgtctacaaggagtacgaagccgaatgc
ggatccattgttttgttcaaaaagttcgatgaaggaaaagttcttttcgaaggcgaagcc
actgagaagaacatcaagaaattcgtcgctggtaactcattgcccctcatcgtcgaattc
aaccatgaaacagcccagaagatcttcggtggcgacatcaagagccaccttttgttgttc
ttgaacaagggcgaagaccacttcgagaaggtgtccgaggctgcaagagccgtcgccaag
cccttcaaggaacaagttttgttcgtcacaatcgacgccggcgaagaagaccaccaaaga
atcttggaattcttcggaatgaagaaagaggaagtcccggcggcgcgtctcatcaagctt
gaggaagacatggccaagtacaagccagaaaccgatgaattatcctctgaaagtatcaag
aaattcgtcgaagatttcctcgccggtaaactcaaacagcatttgctcagtcaagatctt
ccagaagattgggataaggaggcggttaaggttctagtcgccaccaacttcgacagtgtg
gtatttgacgccgacaaggacgttttggtcgagttctacgccccgtggtgcggccactgc
aagcagttggcccccatttacgacaaggtgggcgagcacttcaaagatgacaagagcgtg
gtcgtggcgaagatcgatgccaccgctaacgaactcgaacataccaaaattacgagcttc
cctacattgaaattctatcccaaaggtgggaacaacgttattgaatataacggtccaaga
acattcgaaggtttagttaaatttatcgagtccggtggtgttgacggtgccggtgttgac
gagcccgtcgaagaggaaactgaagatgacgactcacccagaaaagatgagttgttatgt
tcacataaccagaagttattttttaatttagtagttttattgtggtgtcgttacctaatt
cctttcccggatattgttttaattttattcccctgcaaaatggctctgagaaacggtgtt
cgtcgcggtggtgccttaatttctaattatttccgaagttactcaagcgctgggcccctt
gttaacgtcgccgttaacgaaaaaacaggggttgcgacggcaaccctcaaccgcccccct
gtgaacagcatgaatttggagctccttactgaaatatcaaacactttgactcaactggaa
cagaacaagtgtagagggttaattttgacctcgagttccaagagtgtcttcagtgccggc
ttggacatccttgagatgtacaagccggaccccagccgcttgaaagaatggtggactgct
ttacagcaaacttggattaaactttacggttcttcgtaccctactgtggcagttatcaat
ggccacgccccagctgggggctgtttgctgtccttgtcgtgtgaatacagaataatgttg
aacaatttcaccattggcttaaacgagacccaacttgggattgtggccccacaatggttc
attgcgtccatgaggaatgtgattgggacgagacagactgaattggctttaactagcggc
aatcttttctcaactgacgaagctttgaaaattggaatgattgacgaggtggcggctagc
aaagaggatggcattgcaagagcggagaagttttgcggaagattcgccagaattccgcca
attgcaagagccagatccaagttgggagtgcgaggcgctgacatacaagacctcacaaac
aatctccaaaaagattacgaaaatgtggcgaactacgtagctcaggacagtgtgcaaaag
gggttggaaatgtatctgcaatcattgaagcagaaacagaaataa

DBGET integrated database retrieval system