KEGG   Tribolium castaneum (red flour beetle): 664074Help
Entry
664074            CDS       T01046                                 

Definition
(RefSeq) enoyl-CoA delta isomerase 1, mitochondrial-like
  KO
K13238  
3,2-trans-enoyl-CoA isomerase, mitochondrial [EC:5.3.3.8]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Fatty acid degradation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    664074
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     664074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
LG3
AA seq 281 aa AA seqDB search
MALRNGVRRGGALISNYFRSYSSAGPLVNVAVNEKTGVATATLNRPPVNSMNLELLTEIS
NTLTQLEQNKCRGLILTSSSKSVFSAGLDILEMYKPDPSRLKEWWTALQQTWIKLYGSSY
PTVAVINGHAPAGGCLLSLSCEYRIMLNNFTIGLNETQLGIVAPQWFIASMRNVIGTRQT
ELALTSGNLFSTDEALKIGMIDEVAASKEDGIARAEKFCGRFARIPPIARARSKLGVRGA
DIQDLTNNLQKDYENVANYVAQDSVQKGLEMYLQSLKQKQK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagaaacggtgttcgtcgcggtggtgccttaatttctaattatttccgaagt
tactcaagcgctgggccccttgttaacgtcgccgttaacgaaaaaacaggggttgcgacg
gcaaccctcaaccgcccccctgtgaacagcatgaatttggagctccttactgaaatatca
aacactttgactcaactggaacagaacaagtgtagagggttaattttgacctcgagttcc
aagagtgtcttcagtgccggcttggacatccttgagatgtacaagccggaccccagccgc
ttgaaagaatggtggactgctttacagcaaacttggattaaactttacggttcttcgtac
cctactgtggcagttatcaatggccacgccccagctgggggctgtttgctgtccttgtcg
tgtgaatacagaataatgttgaacaatttcaccattggcttaaacgagacccaacttggg
attgtggccccacaatggttcattgcgtccatgaggaatgtgattgggacgagacagact
gaattggctttaactagcggcaatcttttctcaactgacgaagctttgaaaattggaatg
attgacgaggtggcggctagcaaagaggatggcattgcaagagcggagaagttttgcgga
agattcgccagaattccgccaattgcaagagccagatccaagttgggagtgcgaggcgct
gacatacaagacctcacaaacaatctccaaaaagattacgaaaatgtggcgaactacgta
gctcaggacagtgtgcaaaaggggttggaaatgtatctgcaatcattgaagcagaaacag
aaataa

DBGET integrated database retrieval system