KEGG   Tribolium castaneum (red flour beetle): 664096Help
Entry
664096            CDS       T01046                                 

Gene name
Rae1
Definition
RAE1 RNA export 1 homolog
Orthology
K14298  
mRNA export factor
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    664096 (Rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 359 aa AA seqDB search
MFNQSSIGGFGGTPTPSSANPMKDFEVTQPPDDSISSLAFSPATLPQNFLIAASWDNNVR
CWEIEQTGKSVPKSMQACGGPVLDVCWSDDGTKVFMAGCDKQAKAWDLGSNQVIQVAQHD
APIKTCHWIKASNYSCLMTGSWDKTLKFWDTRTPNPMMSINLPERCYCADVDYPMAVVGT
AGRQIIVYQLDGKPQQYKVLDSPLKYQHRCVAIFRDKKKSPTGYALGSVEGRVAIQYVNP
ANPKDNFTFKCHRSNGAPNGYQDIYAVNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLK
SSDLMEQPITRCAFNSNGQIFAYAVSYDWSKGHEFYNSTKKNYIFLRSCYDELKPRTSS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatcagagttcaatcggcggctttgggggcacccccacgccgagttcagcaaac
ccgatgaaggacttcgaagtaacgcagcccccggacgattcgataagttctttggcgttc
tctccggcaacgctcccccagaattttttaatagccgcaagttgggacaacaacgtgcgt
tgttgggaaatcgagcaaacggggaaaagcgtccccaaatccatgcaagcgtgtgggggc
cccgtacttgacgtgtgttggagtgacgatggcacaaaagtgtttatggcggggtgtgat
aaacaggccaaggcctgggatttgggcagtaaccaggtgatacaagttgcgcaacatgat
gcccccattaagacttgtcactggataaaggcttcgaactattcgtgtttaatgaccggg
tcttgggacaagactctcaaattttgggacacgcgcacccctaaccccatgatgagtatt
aatctacctgagaggtgttactgtgccgatgtggattaccctatggcggtggttgggacc
gcagggcgccagatcattgtctaccagctagacggcaagccccagcagtacaaagtgctt
gatagccccctcaaataccagcaccgctgtgtggccatttttagggataaaaagaagtct
ccaactgggtacgctttaggttcggtggaaggccgcgtcgccatccaatacgttaacccg
gcaaaccccaaagacaattttacgtttaagtgccacagatccaacggggcaccgaacggc
tatcaggacatttacgccgtcaatgacattgcattccacccagtccatggcactttggcc
actgttgggtccgatgggtctttcagtttctgggataaggacgcacgcaccaaattgaaa
tcttctgaccttatggaacaaccaatcacgcggtgcgctttcaacagcaatgggcaaatc
ttcgcctacgctgttagctacgactggtccaaaggacacgaattttacaattcaaccaag
aagaattacattttcttgcggtcatgttatgatgaattgaaaccacgaacctcttcataa

DBGET integrated database retrieval system