KEGG   Tribolium castaneum (red flour beetle): 664142Help
Entry
664142            CDS       T01046                                 

Definition
Protoporphyrinogen IX oxidase, putative-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    664142
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     664142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG2
AA seq 467 aa AA seqDB search
MSKVILGGGLGGLSAAYYLKKFSPNQAVTLIESSSRTGGWIKSSVQENGAIFEQGPRTIR
PRGDAGANTLQLIEELNLSDQIVPITSGHPAAKNRLIYANGSLHLLPSSLTGLFRKQEPF
SKPLILHLLNDLKARRKEVKDESIYDFIGRRFGSEVADYLISPLICGICAGNAKEISVKF
LMKQLFEYEQKHGSVSKGLLTSLFAKSKRPTVLCETALRARSEKWNIYSFKNGCETLPIA
LRNNIVSNGVNIKFNTECTEIITDKGQVILNLFNNETIKCDHLVGAIPANVLGRLLQKQH
PELAQCLKKLTKNVSVAVVNLLFKENFIKNPAFGLLVVPKEQLPVLGVIYDSCCFPVENC
GTVLTVMMGGYWFEEHFGTNPQENVLLDVAVKHVKRILNCDHDPFNYKVNILKQCLPQYV
VGHDENLDLINGYIRTHKLPISLCGASYYGVGINDVILSAKNAVKDL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagtgatcctcggcgggggcttgggtggcctgtctgctgcctactacttgaag
aagttttcgcctaaccaagctgttactttaattgagtcttcgtcacgtaccgggggctgg
atcaagtcaagtgtgcaagaaaatggggctatttttgaacaagggcctcgtaccatacgt
ccccggggggatgcaggcgctaatactttacaactgattgaagaactaaatttaagcgat
caaatcgtccctataacttcgggacaccctgctgctaaaaatcggctcatttacgccaac
ggttctttgcatttgttgccgtcgtctttgactggtttgtttaggaaacaagagccgttt
tcaaagcctttgattcttcacttgttgaatgatttgaaagcgaggaggaaggaagtgaag
gatgagtcaatttatgattttatcggtcgcagatttggtagtgaagtggctgattatttg
atcagtccgttgatttgtggcatttgtgccggaaacgccaaggaaattagtgtgaagttt
ttaatgaaacagttgtttgaatacgaacaaaaacatggaagtgtatcaaaggggctcctt
acaagtttgtttgcaaagtcaaaacgaccaactgttctgtgtgaaactgccctcagagct
agaagtgagaaatggaatatttattcctttaaaaatgggtgtgaaacgttacccatagcc
ttaagaaataatattgtttcaaatggggttaatattaaatttaataccgaatgtacggaa
attataacggacaagggccaagtaatactaaatttatttaataacgaaacaattaagtgt
gatcacttagtaggtgcaatacctgcaaacgttttaggacgtcttttacaaaaacagcac
ccggaacttgcccagtgtttgaaaaaactgacaaaaaacgtgtcagtggctgttgttaat
ttactttttaaggagaattttattaaaaatccagcctttggtttattggttgttcctaaa
gaacaacttcctgtgctaggtgttatttacgatagttgttgtttccctgtcgaaaactgt
ggaacggttttaaccgtaatgatgggtggttactggtttgaggaacattttggcacaaat
ccgcaagaaaatgtgttgctggatgttgccgtaaaacacgtgaaacgtatcttaaattgt
gatcacgatccgtttaattataaagtgaatattttaaagcagtgtttgcctcaatatgtt
gtgggtcatgacgaaaatttggacctgattaatggttacataaggacgcataaattacca
atttctttgtgcggtgcctcttattacggtgtggggattaatgatgtaattttgtcggcg
aaaaatgccgtaaaggatttgtaa

DBGET integrated database retrieval system