KEGG   Tribolium castaneum (red flour beetle): 664163Help
Entry
664163            CDS       T01046                                 

Definition
calcineurin subunit B type 2
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    664163
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     664163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG4
AA seq 170 aa AA seqDB search
MGNESSLPMELCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTILFADKDEDGKISFEEFCNVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagagctccctgcccatggagttatgctcaaacttcgacgccgatgagata
cgacgcctcggtaagcgattccggaagctagacttggacaattccggggcgctcagcatc
gacgagttcatgtcgctgccggagctccagcagaatcctctggtgcagcgcgtgattgac
atcttcgacgccgacggcaacggcgaggtggattttaaagagtttatccagggagtgtcg
cagttcagcgtgaagggggacaagctctctaagctgcggtttgcgttccgaatttacgac
atggataacgacgggtttatctcgaatggggagttgtttcaagtgttgaaaatgatggtc
gggaacaatttgaaagacacccaactccagcaaatcgtagataagacaattttgtttgcg
gataaagacgaggacggtaagatttcattcgaggagttttgtaacgtggttggcaacact
gacatccacaaaaagatggtggtggatgtgtag

DBGET integrated database retrieval system