KEGG   Tribolium castaneum (red flour beetle): 664310Help
Entry
664310            CDS       T01046                                 

Definition
similar to histone acetyltransferase Tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 459 aa AA seqDB search
MEEIDDSTICDSVNSLVEGCRLPVHMTGTSDWPLAEIISIKDVQGSKLYYVHYVDFNKRL
DEWVTEESLDTRKVHFPRRDGGSNTGVSTPKKIHIGGGGAIGSVSRPSSPVTAASELVNG
SAVLAAALQKRINRKRKGPSLESEDSQDGPTQMPPGPRQSGSMVSHHDDVVTRMKNIDMI
ELGKHRIKPWYFAPYPQEMVNLSCIYICEFCLKYRKSRKCLERHLVKCNLRHPPGNEIYR
KENVSFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTIFDNRGFHIVGYF
SKEKESTEDFNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYR
SYWAQAILEILISMKPVGDNEKPQITINEICELTSIKKEDVISTLQNLNLINYYKGQYII
TLNQEIMQSHKKAMDSRLIRIDPKCLHWTPKDWGKRAKW
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaatcgacgacagcacaatttgtgattctgtgaattcgttagtggaaggatgc
aggctcccggttcacatgaccggcacttccgactggcctttggccgaaattatcagtatt
aaggacgtgcaaggctcgaaattgtactacgtccattacgttgattttaacaagcgtttg
gacgaatgggtgaccgaagaatcgctcgacactcgtaaagtccacttcccgagacgtgac
ggcgggagtaacactggagtctcaactccgaaaaaaattcacattgggggcggtggtgcc
atcggttcggtatcaaggccctcgagccctgtgacagctgcctccgaacttgtcaacggc
agtgctgtcctagcagcagcgttgcaaaaacgcataaataggaaacgaaaagggccgtct
cttgagagcgaagactcgcaagatgggcccacacagatgcccccagggccgaggcagtct
gggagcatggtgtcgcaccatgacgatgtggtcaccaggatgaagaacatcgatatgatc
gagttagggaaacacaggataaagccgtggtattttgcgccatatccgcaagaaatggtc
aacttgagctgtatatacatctgcgagttttgcctcaagtaccgaaagagcaggaagtgt
ctagaacgccacttggtcaaatgtaatttgagacacccgcccggaaatgagatttatcgc
aaggaaaacgtctcgttttttgaaattgacgggcggaaaaataaagtctacgcccagaat
ttgtgtttgttggcgaagctgttcctcgatcataaaacactgtattacgacacggacccg
tttttgttttacgtaatgaccatttttgataatagagggtttcacattgttggctatttt
tcgaaagagaaggaatcaacggaagattttaacgtcgcgtgtattttaaccatgcctccg
tatcagcgaaagggttacggaaaattactaatcgaatttagttatgaattatcaaagttc
gaaggtaaaacgggttctcccgaaaaacctctctccgatttgggtttgctttcgtatagg
agttactgggcacaagctattttagaaatcttaatatcaatgaagccagtgggtgataac
gagaagccacaaataacgatcaatgaaatttgtgagttgacaagtattaaaaaagaagac
gtcatctcaactttacaaaacttaaacttaatcaattattacaaaggccagtatattata
acgttaaatcaggaaattatgcaaagtcacaaaaaagccatggatagtagacttatccga
atcgaccccaagtgtctgcattggacacctaaagattggggcaaacgcgccaagtggtag

DBGET integrated database retrieval system