KEGG   Tribolium castaneum (red flour beetle): 664310Help
Entry
664310            CDS       T01046                                 

Definition
histone acetyltransferase Tip60
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     664310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 463 aa AA seqDB search
MKVEMEEIDDSTICDSVNSLVEGCRLPVHMTGTSDWPLAEIISIKDVQGSKLYYVHYVDF
NKRLDEWVTEESLDTRKVHFPRRDGGSNTGVSTPKKIHIGGGGAIGSVSRPSSPVTAASE
LVNGSAVLAAALQKRINRKRKGPSLESEDSQDGPTQMPPGPRQSGSMVSHHDDVVTRMKN
IDMIELGKHRIKPWYFAPYPQEMVNLSCIYICEFCLKYRKSRKCLERHLVKCNLRHPPGN
EIYRKENVSFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTIFDNRGFHI
VGYFSKEKESTEDFNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGL
LSYRSYWAQAILEILISMKPVGDNEKPQITINEICELTSIKKEDVISTLQNLNLINYYKG
QYIITLNQEIMQSHKKAMDSRLIRIDPKCLHWTPKDWGKRAKW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggaaatggaggaaatcgacgacagcacaatttgtgattctgtgaattcgtta
gtggaaggatgcaggctcccggttcacatgaccggcacttccgactggcctttggccgaa
attatcagtattaaggacgtgcaaggctcgaaattgtactacgtccattacgttgatttt
aacaagcgtttggacgaatgggtgaccgaagaatcgctcgacactcgtaaagtccacttc
ccgagacgtgacggcgggagtaacactggagtctcaactccgaaaaaaattcacattggg
ggcggtggtgccatcggttcggtatcaaggccctcgagccctgtgacagctgcctccgaa
cttgtcaacggcagtgctgtcctagcagcagcgttgcaaaaacgcataaataggaaacga
aaagggccgtctcttgagagcgaagactcgcaagatgggcccacacagatgcccccaggg
ccgaggcagtctgggagcatggtgtcgcaccatgacgatgtggtcaccaggatgaagaac
atcgatatgatcgagttagggaaacacaggataaagccgtggtattttgcgccatatccg
caagaaatggtcaacttgagctgtatatacatctgcgagttttgcctcaagtaccgaaag
agcaggaagtgtctagaacgccacttggtcaaatgtaatttgagacacccgcccggaaat
gagatttatcgcaaggaaaacgtctcgttttttgaaattgacgggcggaaaaataaagtc
tacgcccagaatttgtgtttgttggcgaagctgttcctcgatcataaaacactgtattac
gacacggacccgtttttgttttacgtaatgaccatttttgataatagagggtttcacatt
gttggctatttttcgaaagagaaggaatcaacggaagattttaacgtcgcgtgtatttta
accatgcctccgtatcagcgaaagggttacggaaaattactaatcgaatttagttatgaa
ttatcaaagttcgaaggtaaaacgggttctcccgaaaaacctctctccgatttgggtttg
ctttcgtataggagttactgggcacaagctattttagaaatcttaatatcaatgaagcca
gtgggtgataacgagaagccacaaataacgatcaatgaaatttgtgagttgacaagtatt
aaaaaagaagacgtcatctcaactttacaaaacttaaacttaatcaattattacaaaggc
cagtatattataacgttaaatcaggaaattatgcaaagtcacaaaaaagccatggatagt
agacttatccgaatcgaccccaagtgtctgcattggacacctaaagattggggcaaacgc
gccaagtggtag

DBGET integrated database retrieval system