KEGG   Tribolium castaneum (red flour beetle): 664393Help
Entry
664393            CDS       T01046                                 

Definition
triosephosphate isomerase-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    664393
   01230 Biosynthesis of amino acids
    664393
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    664393
   00051 Fructose and mannose metabolism
    664393
   00562 Inositol phosphate metabolism
    664393
Enzymes [BR:tca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     664393
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   664393
  Exosomal proteins of bladder cancer cells
   664393
  Exosomal proteins of melanoma cells
   664393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG4
AA seq 247 aa AA seqDB search
MGRKFVVGGNWKMNGDKKQISEIINTLKTGPLSPNTEVIVGVPAIYLEHVRTNLPQSIEV
AAQNCYKVPKGAFTGEISPAMIKDIGVNWVILGHSERRQIFGETDELIAEKVAHALEAGL
KVIACIGETLEEREGGKTEEVVFRQTKAIAGKIKDWSNVVIAYEPVWAIGTGKTATPQQA
QEVHKALRQWFCTHVNADVGNSIRIQYGGSVTGANCKELAAQPDIDGFLVGGASLKPEFV
NIVNAKQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgggccgaaaattcgtagttgggggcaactggaagatgaacggagacaaaaaacaaatc
tccgaaatcatcaacaccctaaaaaccggccccttgagccccaacaccgaagtcatcgtg
ggagtccccgcaatttacttggaacatgtgcgaacaaacctaccccaaagtattgaagtg
gccgcccaaaactgctataaagttcctaaaggcgccttcaccggcgagatttcccccgcg
atgatcaaagacattggcgtgaattgggtgattctggggcactcagagcgtcgccagatt
tttggcgaaactgacgaacttatcgccgaaaaagtggctcatgccttggaggctggcctg
aaagttatcgcctgcattggggagactttggaggaacgggaagggggcaagactgaggag
gttgtcttcagacagactaaggccattgctgggaaaataaaagactggtcaaatgttgtc
attgcttatgagccggtgtgggccataggtacgggaaaaactgccactcctcaacaagca
caagaagtgcacaaggccttgaggcaatggttttgcacacacgttaacgcggacgttgga
aatagtatcagaattcaatacgggggctccgtaactggggccaactgcaaagaattggct
gcccaacctgatattgacggatttttagtagggggtgcgtccctcaaacccgaattcgtg
aacattgtaaacgcaaagcaataa

DBGET integrated database retrieval system