KEGG   Tribolium castaneum (red flour beetle): 664409Help
Entry
664409            CDS       T01046                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    664409
Enzymes [BR:tca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     664409
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   664409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 339 aa AA seqDB search
MSIQKKVKNRHTLHSGIFNPTLRKWQSLQSEIAPDNLMYPIFIVEDDEAVQPIASMPGVS
RYGVNKLKNHLGPLVEKGLSSVLLFGVVESLPKDDTGSHADSPQNPVIRALPKLLSWFPS
LTIACDVCLCPYTSHGHCGILFPDGSINNTKSIKRIAEIAAAYAKAGAHIVAPSDMMDGR
IGAIKDKLAECQLRHKTAVLSYTAKFASGFYGPFRDAAKSKPAFGDRKCYQLPPGSSGIA
LRAAARDVAEGADMLMVKPVLSYMDVLRDVKRAYPEFPMFVYQVSGEYAMIYHAAKAGAL
DFKTALSEILVSLRRAGADVIISYYTPVVLDWLQTKSKL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagtatccaaaaaaaagtcaagaaccgccacacactccacagcggcatattcaaccct
actctgcgaaagtggcaaagtctccagtctgaaatagcccccgacaacctcatgtacccc
attttcatcgttgaggacgacgaggctgtgcaacctatcgcctcaatgcctggagtttcg
cgctatggcgttaacaaactgaaaaaccatttaggaccgcttgttgagaaggggttatcg
tcagtgcttctgtttggcgtagtcgaaagcctcccaaaagacgacaccggcagccacgct
gacagcccccaaaaccccgtgattcgggccctcccgaagttactttcgtggttcccttcc
ctaaccattgcttgcgacgtctgtctttgtccttacacctctcatggccattgcgggatt
ttattcccggacggctctattaataacactaaaagtatcaagcgcattgccgagatagca
gcggcctatgccaaagcgggcgcccacattgtggctccttctgacatgatggatggccga
attggggctatcaaagacaagttagcagagtgccagttgagacacaagactgccgtgttg
tcgtacacggccaagtttgcgtcgggtttctacggcccctttagagacgccgctaagtcg
aaaccggcttttggcgacaggaaatgttatcagttgcccccagggagttcagggattgcg
ttacgtgccgctgcgagggacgtagccgagggggctgatatgctcatggttaagcccgtg
ctgagctatatggatgtcttaagggacgtgaaaagggcgtatcctgagtttccaatgttt
gtgtatcaggtgtcaggggaatatgctatgatttatcacgcggctaaagcgggcgctttg
gattttaaaacagcactaagcgagattttggtgtctttgagacgtgcaggggccgatgta
attatttcgtattacacccctgtggttttagactggttgcaaacgaaaagtaagctgtga

DBGET integrated database retrieval system