KEGG   Tribolium castaneum (red flour beetle): 664516Help
Entry
664516            CDS       T01046                                 

Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00511  Other glycan degradation
tca00600  Sphingolipid metabolism
tca01100  Metabolic pathways
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    664516
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    664516
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    664516
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     664516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydr_30_2 Alpha-L-AF_C
Motif
Other DBs
NCBI-GeneID: 664516
NCBI-ProteinID: XP_975608
UniProt: D6WRN0
Position
LG7
AA seq 505 aa AA seqDB search
MLAKILLLFLLTGFSHTQECLSRDYGHGGTVCVCNATHCDTVPQPEKVEPSELLVYTSNK
AGLRFHLEKKKFESSNLLDNQIIINPKEKYQTILGWGGAFTDATGINIASLEEELQSKLL
ESYFSENGIEYSLCRVPIGGTDFSVRAYSYDDGEEDKNLTNFKLAEEDHQYKIPYIKKAL
NLTGNNLKLFASAWTAPTWMKTNGEYTGFGFLKEEMFQTWANYFVKFLDEYEEQGVEFWG
ITTGNEPSLALVPLNQINSVGWDATEMGKWIVNNLGPTIRNSTHQNIKIMILDDQRLFLP
WFVDLALKDNSTRSYIDGVAIHWYLNNIVPITVVNETHSHFPEKFILATEACNGIQLGVG
PVVLGSWERGEYYSFDIIEDLLNWVSGWVDWNMVLDLTGGPTYINNNVDSPIIVNASAGE
FYKQPMYYHLGHFSKFLPRHSVRIAVSNTIEENVLVVAFQRPDNATAVIILNRNEDVVPV
SVTDPKRGTAQLEISEKSITTLLYW
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaaaaattcttctcctatttttgctcacaggattttcgcatacacaggagtgt
ttgagcagagattacggccatggtggtactgtatgtgtatgtaatgcgacccattgcgat
actgttccgcagccagagaaagtagaaccgtctgagcttctggtctacacttccaataaa
gcgggtttaaggtttcatctagaaaagaaaaaatttgaatcgtctaatcttttggataat
cagatcataatcaatcctaaagaaaagtaccaaaccattctgggttggggtggtgctttt
actgacgcaactggaatcaatattgcttccttagaagaggaacttcaaagcaaacttcta
gaatcttacttttctgaaaacggtattgagtatagtttgtgtagagtcccgattggtgga
accgacttttcggttcgtgcctactcgtatgatgacggtgaagaagacaaaaacttgacc
aactttaaactagctgaagaagatcatcagtataaaataccgtatattaaaaaagcacta
aatctaactgggaataatttgaagttatttgcttctgcttggactgcaccaacatggatg
aaaaccaacggggaatatacaggttttggctttcttaaagaagaaatgtttcaaacttgg
gctaattactttgttaaatttttggacgagtatgaagaacaaggagtggaattttggggt
ataaccacaggaaatgaacctagtttagctctagtgcctctgaatcaaatcaatagcgtt
ggttgggatgccactgaaatgggtaaatggatagtgaataatttaggaccaacaatcaga
aattcgacacatcaaaacataaaaattatgattctggatgatcaaagattattccttcca
tggtttgtagatttggccctcaaagacaactccactcggagttacatagacggggtcgca
atccattggtatttgaacaacatcgttcctataacagtagtgaatgaaacacattcgcat
ttcccggaaaaatttattttagctactgaagcttgcaatggaattcagctgggtgtgggt
ccggtagttttaggctcttgggaacgaggagaatattactcattcgacataattgaggac
ttgttaaattgggtcagtggttgggttgactggaatatggtactcgatttgacaggtggc
ccaacttacattaacaataacgtagattctccgataattgtaaacgcgtcagctggagaa
ttttataaacaacccatgtactaccatctggggcacttttcaaaatttttgccacggcat
tctgtacgaattgccgtgagtaataccatagaggaaaatgtgttggtggtggcgtttcaa
aggccagataacgccacagctgtgataattttaaacagaaatgaagacgtggtccctgtg
agtgttactgatcctaaaaggggcacagcacaattagaaatcagtgaaaagtcaattacg
actctgctgtactggtaa

DBGET integrated database retrieval system