KEGG   Tribolium castaneum (red flour beetle): 664516Help
Entry
664516            CDS       T01046                                 

Definition
similar to glucocerebrosidase precursor
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tca00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tca00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tca04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 505 aa AA seqDB search
MLAKILLLFLLTGFSHTQECLSRDYGHGGTVCVCNATHCDTVPQPEKVEPSELLVYTSNK
AGLRFHLEKKKFESSNLLDNQIIINPKEKYQTILGWGGAFTDATGINIASLEEELQSKLL
ESYFSENGIEYSLCRVPIGGTDFSVRAYSYDDGEEDKNLTNFKLAEEDHQYKIPYIKKAL
NLTGNNLKLFASAWTAPTWMKTNGEYTGFGFLKEEMFQTWANYFVKFLDEYEEQGVEFWG
ITTGNEPSLALVPLNQINSVGWDATEMGKWIVNNLGPTIRNSTHQNIKIMILDDQRLFLP
WFVDLALKDNSTRSYIDGVAIHWYLNNIVPITVVNETHSHFPEKFILATEACNGIQLGVG
PVVLGSWERGEYYSFDIIEDLLNWVSGWVDWNMVLDLTGGPTYINNNVDSPIIVNASAGE
FYKQPMYYHLGHFSKFLPRHSVRIAVSNTIEENVLVVAFQRPDNATAVIILNRNEDVVPV
SVTDPKRGTAQLEISEKSITTLLYW
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgttggcaaaaattcttctcctatttttgctcacaggattttcgcatacacaggagtgt
ttgagcagagattacggccatggtggtactgtatgtgtatgtaatgcgacccattgcgat
actgttccgcagccagagaaagtagaaccgtctgagcttctggtctacacttccaataaa
gcgggtttaaggtttcatctagaaaagaaaaaatttgaatcgtctaatcttttggataat
cagatcataatcaatcctaaagaaaagtaccaaaccattctgggttggggtggtgctttt
actgacgcaactggaatcaatattgcttccttagaagaggaacttcaaagcaaacttcta
gaatcttacttttctgaaaacggtattgagtatagtttgtgtagagtcccgattggtgga
accgacttttcggttcgtgcctactcgtatgatgacggtgaagaagacaaaaacttgacc
aactttaaactagctgaagaagatcatcagtataaaataccgtatattaaaaaagcacta
aatctaactgggaataatttgaagttatttgcttctgcttggactgcaccaacatggatg
aaaaccaacggggaatatacaggttttggctttcttaaagaagaaatgtttcaaacttgg
gctaattactttgttaaatttttggacgagtatgaagaacaaggagtggaattttggggt
ataaccacaggaaatgaacctagtttagctctagtgcctctgaatcaaatcaatagcgtt
ggttgggatgccactgaaatgggtaaatggatagtgaataatttaggaccaacaatcaga
aattcgacacatcaaaacataaaaattatgattctggatgatcaaagattattccttcca
tggtttgtagatttggccctcaaagacaactccactcggagttacatagacggggtcgca
atccattggtatttgaacaacatcgttcctataacagtagtgaatgaaacacattcgcat
ttcccggaaaaatttattttagctactgaagcttgcaatggaattcagctgggtgtgggt
ccggtagttttaggctcttgggaacgaggagaatattactcattcgacataattgaggac
ttgttaaattgggtcagtggttgggttgactggaatatggtactcgatttgacaggtggc
ccaacttacattaacaataacgtagattctccgataattgtaaacgcgtcagctggagaa
ttttataaacaacccatgtactaccatctggggcacttttcaaaatttttgccacggcat
tctgtacgaattgccgtgagtaataccatagaggaaaatgtgttggtggtggcgtttcaa
aggccagataacgccacagctgtgataattttaaacagaaatgaagacgtggtccctgtg
agtgttactgatcctaaaaggggcacagcacaattagaaatcagtgaaaagtcaattacg
actctgctgtactggtaa

DBGET integrated database retrieval system