KEGG   Tribolium castaneum (red flour beetle): 664562Help
Entry
664562            CDS       T01046                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    664562
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    664562
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    664562
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     664562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 508 aa AA seqDB search
MLVLLLVLSTLSFSNCQQCQSRDYGNGGTVCVCNATYCDTIARPQRVPPSQFLTYTSNLA
GLRFSQTSGTFAPRPNSSNRIYLNSSRVYQTIIGWGGAFTDATGINIESLPANMREMLLE
SYYSPNGLEYSLGRVPIGGTDFSVRPYSYDDGGPDPDLINFALAPEDLLYKIPNIQRAIN
LTNGNIKLFASAWTAPRWMKTNGDYSGYGFIRRFFYQTWANYYVRFLDEYRRRGVNFWGI
TTGNEPADALNPFDQLEVVGWPSWLIGDWILNNLGPTIRGSPNYSNLTIMILDDQRVFLP
WYIVRALNNNRTRQYIDGIAVHWYLDLYSSPDLLDQTQRLFPEKFILGTEASVMPASYET
PVLLGSWTRGEEYSSDIITDMQHWVTGWVDWNMALNPDGGPNYIRNFVDSTIIVNATSAE
FYKQPTYYHFGHFSKFVPRGSVRIDCNLVLSDNSTDVDSVAFRRPDNGTAVVILNRNPTA
VSLNILDNSRGTAPIAITAKSITTVLYW
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctggtactgctgttggttctgtccaccctaagtttttcaaactgccaacaatgccaa
agtcgcgattacggcaacggggggaccgtgtgtgtgtgcaacgccacgtattgtgacaca
atcgcaagaccccaaagagtgcccccatcccaatttctcacatacacctccaacttggct
ggcctgagattcagccaaacgagtgggacgtttgcccctcgacccaactcctccaaccgt
atttacctaaactcgagcagggtgtaccaaacaatcattggctggggtggagctttcact
gatgcgaccggaatcaacattgaatcgctaccagccaacatgcgggaaatgttactagaa
tcgtactattcgcccaatgggcttgaatacagtcttgggagagttccgattggagggacg
gatttttcggtacgaccgtactcttatgacgatggtggaccggatccagacctgattaat
tttgccctagccccggaagatttactctataaaattccaaatattcaaagggcaattaat
ttgacaaacggcaacatcaagctttttgcctcagcatggacggcacccagatggatgaaa
acgaatggggactacagcggatatggatttattcgaaggtttttctaccagacttgggca
aactactatgtcaggtttttggatgagtaccgacgacgcggtgtcaatttttggggaatt
accacagggaacgaaccagctgatgctttgaaccctttcgaccagcttgaagtcgttggt
tggccttcatggttgattggagactggattttaaacaatctaggaccaacaattcgagga
tctcctaattactcaaatctgacaattatgatacttgatgatcaaagagtatttctgcct
tggtatatagtcagagcactaaataataacagaacgcgacaatatatcgacggtattgct
gttcactggtacctggacttatactcctcaccagatttgctagaccagactcagagactt
ttccctgagaaattcattttagggacggaggctagtgtcatgccagcttcgtacgaaacg
ccagttttattaggttcatggacacgcggtgaagaatattcttccgacataataacagat
atgcaacactgggtcaccggttgggtcgactggaacatggcgctgaatcctgatggtggg
cccaattacatccgaaacttcgtcgactccaccatcatagtaaacgccacgagtgccgag
ttttacaaacaacccacctattaccacttcggacatttctccaaatttgtacccagagga
tcagttaggattgactgcaacctagtcctcagcgataactctacggatgttgacagtgtt
gctttcagaagaccggacaatggtaccgccgtagtcattttaaacagaaacccaacagca
gtatcgctcaacatattggataactctagaggtaccgcccccatagcaataacagcaaaa
tccattacaactgttttgtactggtaa

DBGET integrated database retrieval system