KEGG   Tribolium castaneum (red flour beetle): 664565Help
Entry
664565            CDS       T01046                                 

Definition
similar to CG15319-PB
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    664565
   04330 Notch signaling pathway
    664565
   04350 TGF-beta signaling pathway
    664565
   04630 Jak-STAT signaling pathway
    664565
   04068 FoxO signaling pathway
    664565
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     664565
Transcription factors [BR:tca03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    664565
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    664565
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG4
AA seq 2220 aa AA seqDB search
MADHLVDGPPNAKRQKLDPFQGPSDSSAYYGPAMGGGGHEHDQHQWNMSHNQNVLSNMDM
FDLENDLPDELITPTSWPISDNMGNSKPPPHGPGPGTGMQNGIDSGDNSNNLRQLQLNML
QSNKGLISNALAMAGGQLGNKSPNLQSPPNVSVAKGNVVDQMNLGSLASSISNSGGLQSM
ANNGTSPQIMSSIQGMNNSAGGNMIMTNSSMSTMAGMAGGGLVVSSTVNKPLANATNMLA
PGQPHHPGNHTVPQQPMQNGPMLGRVTMQHLNARAPGPHGVHPLGTRMQAPGMMQLGGAV
GQGMPGNTPYSYPNAGPQGVATPQPHANKLGLPQTRFGGPGGPVGPAGGGEGGMAPTQLP
APSPAQPQSGAPSGTQPGPQTATQNQGAGPPPSSTDPEKRKLIQQQLVLLLHAHKCQRRE
AQANGEVWQCNLPHCKTMKNVLNHMTTCNAGKSCSVAHCSSSRQIISHWKHCTKMDCPVC
LPLKQADKNRNNNPNATTNPPQSTQSINPSDMRRAYDALGMQCPTTGAGTAPTGLIPNAG
PQRPCIRLPIAGGPNMAAGLGVRGMAPGAVQPAPNVSLPLGSDSAQNTNQGVSQVAANLQ
QSISIFGLSNDGTGQGLIAPGGLQAGQVTASPVQGTKEWHQSVTPDLRNHLVHKLVQAIF
PTPDPQAMLDKRMHNLVAYARKVEGDMYEMANSRSEYYHLLAEKIYKIQKELEEKRQKRK
ELQLQQQHTQPPQIRPNLQGAVPGVVTRPPGVPGGLPQGQQPGLRSGSPALGNMATLNQA
GGRLFPVQQNQNQSNVVGLPGPSPTASNPGLSPFGQPMSQNSNASTSAGNQFGTSNGPVS
LPQASPASSTQNQFNDLMKNRLAPSPSAFGLQSQIQNQNQVNNNLNATRITPNSETVMTP
HAAGPKSVSSSRGPSPAPATPVQSSPATAASLGKGMSSAERAAQNAPRQSSMSSQMAAIT
AAHDRDEESPSPPPNSIKGKLEQMKEENSMDVKHIKQEVEEEPGQSEGGKNIKNEMQMDI
KSEMKTEPMDDCEGKIKEEVSDGSLDVRPSTSDGALVPMACNVDKKPKKCFFKFDELRQK
LMPTLEKLYRQDPESLPFRQPVDPQTLGIPDYFDIVKRPMDLSTIKKKLDIGQYTDPWEY
VDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEMEIDPVMQSMGYCCGRKYTFNPQVLCC
YGKQLCTIPRDAKYYSYQNRWVFETYGLGSDRYTFCQKCFNDIQGDTVTLGDDPTQAQTA
IKKDQFKEMKNDHLEMEAFVHCTDCGRKLHQICVLYNENIWTQGFTCDECLKKKGQKRRD
NKFNAKRLPVTKLGVYIETRVNNFLKKKEAGAGEVSIRVVSSSEKTVEVKPGMRGKFVET
GELASEFPYRAKALFAFEEIDGVDVCFFGMHVQEYGSECPPPNTRRVYIAYLDSVHFFKP
RQFRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPVEQKIPKPKRLQDW
YKKMLDKGIIERIVLDYKDILKQAMEDNLRSAADLPYFEGDFWPNVLEESIKELDQEEEE
KRKQAEAAEAAANAIFSLTEECETGPDGKKKGQKKAKKSNKSKANQRKNSSKKSNTPQTG
NDLSAKIFATMEKHKEVFFVIRLHSVQSAASLGPIQDPDPFINCDLMDGRDAFLTLAREK
HYEFSSLRRAKYSTMCMLYELHNQGQDKFVYTCNNCKSHVETRYHCTVCDDFDLCIQCYD
KEGHPHKMERLGFDLDDGSSPSDQKQANPQEARKLSIQRCIHSLVHACQCRDANCRLTSC
QKMKRVVTHTKVCKRKTNGGCPICKQLIALCCYHAKHCQETKCPVPFCSNIKHKLKQQQL
QQRLQQAQLLRRRMAVMNTRTLPQGNAMPGANTVGLSSGGQSVGPGAISPANSMNSSTMA
NSAMGMQSPHQPGIGLKPGTQTPPPNVLQVVKQVQEEAARQQAPHVGYGKVTPGGGVPGQ
NMPPPQMRHMEGGNLLPMTQWQRYPGGAAQGIRQPGPQLIQQGQMGQAPMQPNQGGVRPG
AGSITNPQNAMQKQALQQLMQTLRSPQSPEQQQQILTILKANPQLMAAFIKQRQQQLRSP
PPIRSPQPSPSSRPSPSPRNQAVASPRGPQPSPHDMAASEMLLGQNHTGSLHPHASPVGG
SNQETGEVPAMTPQDQLSCLPQSGLKNINYYTNPTPKKHQTLTHSYDHHNRAKQNQIRQN
NT seq 6663 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccatctcgtcgacggacccccgaacgccaaacggcagaagctggaccccttc
caggggccctcagactcctcagcttactacggcccggccatggggggtggtggacacgaa
cacgaccagcaccagtggaacatgagccacaatcaaaatgttctttcgaacatggatatg
ttcgatctggagaacgaccttcctgacgagttgataacgccgacgtcgtggccgatctcc
gacaacatgggaaacagcaaaccgccgcctcatggtcccggtcccggaacagggatgcaa
aatgggatcgacagcggtgacaacagtaacaatttacgccaacttcagctcaatatgctc
cagagcaataaaggtttaataagtaacgcactggcaatggccgggggacaattaggcaac
aaaagtcctaatttacaatcgccacccaacgtttcggtggcgaaaggtaatgtcgtggat
caaatgaatttggggagtttggcgtcgagtatttcgaatagtggtggattacagtcaatg
gctaataatggaacgtcaccacaaattatgagttcaattcaagggatgaataatagtgcc
ggtggtaatatgattatgacgaatagtagtatgagtactatggcgggaatggctggaggt
gggttggttgttagtagtacggtgaataaaccgttggcaaatgcgacgaatatgttggca
ccgggacaaccacatcatcccgggaaccatacagtacctcaacagccaatgcaaaatggt
ccgatgctgggccgcgtcacaatgcaacatttgaacgcgcgcgctccaggcccccacggc
gtccatccactcggtacccggatgcaagccccgggtatgatgcaattgggcggcgctgtg
ggccaaggaatgcctggaaatactccttattcatatcccaatgccggacctcaaggtgtt
gccacaccgcaacctcacgctaataaattaggacttcctcaaacgaggttcgggggacct
ggaggtcccgtcggaccggccggaggcggcgaaggtggaatggcaccaactcaattgcct
gcaccctcacctgcccaaccccaatccggagctccatccggaacgcaacccggaccgcaa
accgccacccaaaaccagggagcgggaccgccaccgtcttcgacggacccagaaaaacga
aagttgatccaacaacaattagtgttgttactacacgcacataagtgtcaaagacgagag
gcgcaagccaacggtgaagtgtggcagtgtaatttaccgcattgtaaaacgatgaaaaac
gttttaaatcatatgacgacgtgtaatgcgggaaaaagttgttccgtggcgcattgtagt
tcctcgagacagattataagtcactggaagcactgtacgaaaatggactgcccggtttgt
ttaccattgaaacaagccgataaaaaccgaaataataaccctaacgcaacgactaatccg
cctcagagtactcagtcgattaacccatcggacatgcgtcgtgcctacgatgctctaggc
atgcagtgtccgacgacgggggcaggtaccgcccccacgggtctcattcccaacgctggc
ccgcaacgcccttgcatccgattacccatcgccggcggtcccaatatggccgctggtctg
ggagtcagagggatggcccccggcgctgtccaacccgcccccaacgttagtctacctctc
ggtagcgattcggcacaaaataccaaccaaggagtgagtcaagtcgccgcgaatctccaa
caaagcatttcgattttcggtctttcaaacgacggcactggacaaggactcattgcaccg
ggagggttacaagccggtcaggtgaccgcatcaccagttcaagggaccaaagaatggcac
cagtcggtcacacccgatctcagaaaccatctggtgcataaattagtacaagcgattttt
ccaacacccgatccacaagcgatgctcgataagagaatgcataatttagtagcctatgcg
cggaaagtcgaaggtgatatgtacgaaatggcaaactcgagatctgagtactatcacctt
ctcgccgaaaagatttacaaaattcaaaaagagttggaagagaagcgacaaaaaagaaag
gaactacaactacaacaacagcacacacaacctccacaaatacgaccaaatttgcaagga
gccgttcccggagtcgtcacgagaccacctggggttcctggaggtttaccacaaggccaa
caaccaggattacgtagcggttctcccgcattaggtaacatggccacactgaaccaagcc
ggaggtcgcttattcccagtacaacaaaaccaaaatcaaagcaatgtcgtgggacttcca
ggcccgagtcccactgcctcaaatccgggattatcgccattcggccaaccaatgtcacaa
aacagtaacgcgtctacgtcagcaggtaaccagttcggtacttcaaacggacctgtgagc
cttcctcaagcatcaccagcgagctcgactcaaaatcagtttaacgacttgatgaaaaat
cgtctcgcaccttcaccctccgcttttggtcttcaatctcaaattcaaaatcaaaaccaa
gtcaataataatttaaatgcgactcgaataacgccaaattcggaaacagtaatgacgccg
cacgctgccggccccaaatcggtgagttcgtcgcgggggccgtcaccagcacctgccacc
cccgtgcaatcttcacccgccaccgcagccagtctgggtaaaggcatgtcgagtgcagaa
cgagcggctcaaaatgcaccaagacagtcgtcgatgtcgtctcagatggcggcgattacg
gcggcacatgatcgcgacgaagagtcgccttcgccgcctccgaatagtatcaaggggaaa
ttggaacagatgaaagaggagaattcgatggacgttaagcatataaaacaagaagttgaa
gaagaacctgggcagagtgaaggtgggaagaatataaagaacgagatgcagatggatatt
aaatcagaaatgaaaacggaaccaatggatgattgtgaaggaaaaatcaaagaggaggtg
tctgatggttcgttggacgtaaggccttccacttcggacggggcgttagtaccgatggcc
tgtaacgtggacaagaaaccgaaaaaatgcttttttaaatttgacgagcttcgccagaag
ttaatgccgactttggagaaactctaccgacaagatcctgaaagtctgccgtttagacaa
ccggtagatccccaaactttgggcatacccgactactttgacattgtaaaaagaccaatg
gacttatctacgatcaaaaagaaacttgatattggtcaatataccgacccttgggaatac
gtcgacgacgtttggttgatgtttgacaacgcgtggttgtataacagaaaaactagccgg
gtttatcgatattgtactaaattatctgaagtatttgaaatggaaatcgatccggtgatg
caatccatgggttactgttgcggcaggaaatacacttttaatccgcaagtcttgtgttgt
tacggaaagcaattatgtacaattccacgcgacgccaaatactacagttatcaaaatagg
tgggtatttgaaacatatggactcggctccgacagatacaccttctgccagaagtgcttc
aacgatatccaaggcgatacggtaaccctaggcgatgatccgacccaagcgcaaacggcg
ataaagaaggatcagtttaaagaaatgaaaaacgatcatttagaaatggaagctttcgtc
cattgtactgactgcgggcgaaaactgcaccaaatttgcgtactctacaacgaaaacatc
tggacgcaaggtttcacttgcgacgaatgtctaaagaaaaaaggtcagaaacgtcgcgat
aataaatttaacgcgaaacgactccccgttacgaagttaggtgtgtacatagaaacgcgt
gtgaataactttttgaaaaagaaggaagccggtgccggtgaggtttcgattcgggtcgtt
tcgagttcggaaaaaacagtcgaagtgaaaccgggaatgcgtggaaagtttgtcgaaacg
ggcgaactagcgtccgaatttccttacagagcgaaagctctattcgcgttcgaggaaatc
gacggcgtggacgtttgtttcttcggaatgcacgtccaggaatacgggtcggaatgtccg
ccgccaaatacgcgacgcgtgtacattgcttacctcgattctgtacattttttcaaaccg
agacagtttcgaactgccgtctaccatgagattttattggggtacatggactatgtgaaa
cagttagggtatactatggcacacatttgggcgtgtccgccgtccgaaggtgacgattat
atcttccattgtcatccggtcgaacaaaaaatccccaaaccgaaaagactgcaagactgg
tataagaaaatgttagacaaagggatcatcgaaaggatagttctcgattataaggatatt
ttgaagcaagcaatggaagataatttgaggtcggcggcagacttgccgtatttcgaggga
gatttctggcctaatgttctcgaagaaagtataaaagaactggaccaggaggaagaagag
aagaggaagcaagcggaagctgccgaagcggcggcaaatgcgatattttccttgacggaa
gagtgtgagactggtcccgatggtaagaagaaaggtcagaaaaaagccaagaagagtaat
aaatcgaaagcgaatcagagaaaaaatagtagtaaaaaatcgaatactcctcaaacgggt
aatgatctctcggcgaagatcttcgcaacgatggaaaaacacaaagaagtattcttcgtc
ataaggctacattcagtgcaatcggcggcgagtcttgggccgattcaagatcctgatccg
tttatcaactgcgatctgatggatggtcgcgacgctttccttaccctcgcccgcgaaaaa
cactacgaattttcatcactacgtcgcgccaagtacagtaccatgtgtatgctgtacgaa
ctgcacaaccaaggccaagacaaatttgtttacacctgcaataactgcaaaagtcacgtg
gagacgcgctaccattgcaccgtctgtgacgatttcgatctctgcattcaatgctacgac
aaagagggtcatcctcacaaaatggaaagactcggtttcgatctcgatgatggttcctcg
cccagcgatcaaaaacaagccaatccgcaagaagcacgaaaactatcgatacaacgttgt
atccattccctggtacacgcgtgtcaatgcagggacgccaactgccgacttaccagctgt
cagaagatgaaacgcgttgttacacataccaaagtttgtaagaggaaaacgaacggtggc
tgtccgatttgtaaacaattgatcgcgttgtgttgttaccacgccaaacactgccaagag
accaaatgtccagtgccgttctgttcgaatattaagcataagttgaagcaacagcagttg
cagcagcggttgcaacaagcgcagttgttgcgtcgacgaatggccgtgatgaatacgagg
actttgccgcaaggcaacgcgatgccgggcgctaatactgtcgggttgtcgtcgggagga
caatcggtggggccgggggcgataagtccggccaactcgatgaattcgtcaacgatggcg
aatagtgcgatgggaatgcaatcgccccatcagccgggcataggactgaaaccggggacg
caaacaccacccccaaatgtactacaagtggtgaagcaagtgcaagaggaggcggcaagg
caacaagcaccccacgttggatacgggaaagtgacgccgggtggtggagtcccgggacag
aacatgccgccgccgcagatgagacacatggaagggggtaatttattaccgatgacccaa
tggcaaaggtatccaggcggtgccgctcaaggtatccgccaacccggccctcaactcatt
caacaaggccaaatgggtcaagcccccatgcaacctaatcaaggtggtgtccgtcccggc
gccgggagcatcacaaatccacaaaacgcaatgcaaaaacaagcattgcaacaattaatg
cagactttacggtcgccacaatcgcccgaacaacagcaacaaattttgacgatacttaaa
gccaatccacaattaatggcggcctttattaaacaaagacagcaacagttgaggagtccg
cctccgattaggagtccacagccgagtccgtcgtcgcggccgtcgccgagtccgaggaat
caggcagtggcgagtccaagggggcctcaaccgagtccgcacgacatggcggcgtcggag
atgttactaggacagaaccatacggggtctttgcatccccacgcgtcaccagtcgggggt
tcgaaccaggaaacgggcgaagtgccggcgatgacgccccaagaccagttgagctgttta
ccacaatcggggctaaaaaacatcaattactacaccaaccccacccccaagaaacaccaa
acccttacccactcgtatgatcaccacaatcgagcaaaacaaaaccaaattcgccaaaac
tga

DBGET integrated database retrieval system