KEGG   Tribolium castaneum (red flour beetle): 664569Help
Entry
664569            CDS       T01046                                 

Definition
similar to Beta-hexosaminidase alpha chain precursor (N-acetyl-beta-glucosaminidase) (Beta-N-acetylhexosaminidase) (Hexosaminidase A)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    664569
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    664569
   00603 Glycosphingolipid biosynthesis - globo series
    664569
   00604 Glycosphingolipid biosynthesis - ganglio series
    664569
   00511 Other glycan degradation
    664569
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    664569
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     664569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
LG7
AA seq 545 aa AA seqDB search
MMFKLFFLLLIISFCSAFDFIFQPGPLVPASKGEIWPKPQHENKLDDGFFSLLPTFFHFN
PIGNICNTLTEALDRYRKLIIFNNRRIKEVYYKARSCYEGGDQNFLGYLTSVEVELTGAC
NDEEYPSFEMKEEYVVNVTSTVQRISSDTIWGILRGLETFSQLIYLTDDYSCHRIGTTSI
HDYPRFAHRGLLLDTSRHYIPKEHILKLIETMSYNKLNVFHWHITDDYSFPYVSKAFPQM
SNKGAFHPTLMIYEQDFVSEVQEYARKRGIRVLAEFDTPGHTLSWGLGNPDLLTDCHNVP
QLKWGPINPIKNTTYDFIFKLFEEIKSVFKDEYTHLGGDEVDFSCWKSNPEINQWMAEHQ
MEGDYVALQSHYIQKLINHVDSLGLNSIVWEEVFTNGVQLPKSTVVNVWISDDPKTTLKQ
VTEAGHPTIISSYWYLDILKTGGDWLKFYNADPQDFDGTDEQKRLVLGGEACMWSEVVDE
YNLEPRVWPRASVAAERFWSPPDTPKSAQNLGELWTIASRLQEQTCRMNRRGVAAQPPSG
PSVCF
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgatgttcaaactatttttccttttactcataatttcattttgttcggctttcgatttc
attttccaacccggcccacttgttccggcttcgaaaggcgaaatatggccaaagccccaa
catgaaaataaattagacgatggattcttctctttgttaccaacattctttcatttcaat
ccaatcggaaacatctgtaacacgttaactgaagctttggacagatacagaaagttgatc
atatttaacaatcgccgaataaaggaggtttattacaaagcgcgcagttgctacgaaggc
ggagatcaaaattttttgggctatttgacaagcgtggaagttgaattgactggtgcttgt
aacgatgaagagtacccctcatttgagatgaaagaagaatatgttgtaaacgtaacgtca
acagtgcaaagaatttcctcagacactatatggggaatacttcgggggctcgaaactttc
tcacaattgatatacttgacagacgattacagttgtcacagaattggaacaacttcaatt
cacgattaccccagatttgcccatcgcggactacttttggacacttcccgtcattacatc
ccaaaagagcacattttgaagttaatcgagacaatgtcttacaacaaattaaatgttttc
cactggcatatcactgacgattacagttttccctacgtcagtaaagctttcccgcaaatg
agcaataagggagcattccatccgactctcatgatttacgagcaagactttgtaagcgaa
gtgcaagagtatgctcgaaaacgcggaattcgtgttttggcagagttcgatacccctggc
cataccctttcttggggtctgggaaacccagacttgctcaccgattgccacaacgtaccc
caacttaagtggggacccatcaaccccattaaaaacaccacctacgacttcattttcaaa
ctattcgaagaaatcaaaagcgttttcaaagacgaatacacgcaccttggcggcgacgaa
gtcgatttctcttgctggaaaagcaacccagaaatcaaccaatggatggctgagcaccag
atggagggcgattacgtcgccctgcaaagccactacatccaaaaactcatcaaccacgtc
gattctttaggtttaaactcaattgtttgggaagaagtgttcaccaacggtgtccaacta
cccaaatccacagtagtcaacgtctggattagcgatgacccgaaaacaaccctcaaacaa
gtaacagaagctggccatccaacaatcatctcatcttactggtatttggatattttgaag
accggaggtgattggttaaaattctacaatgctgacccgcaagactttgatggtactgac
gaacaaaaaagacttgttcttggaggggaggcgtgtatgtggagcgaagtcgttgatgag
tataacttggagccaagggtgtggccgagagctagtgtggcggcggagaggttttggtcg
cctccagacactcccaaaagtgcgcaaaatttaggagagctttggactatcgctagcagg
ctacaagagcagacttgcagaatgaacaggagaggggtggcggcacagccgccttcagga
ccaagtgtttgtttttaa

DBGET integrated database retrieval system