KEGG   Tribolium castaneum (red flour beetle): 664573Help
Entry
664573            CDS       T01046                                 

Gene name
Ndufs4
Definition
NADH dehydrogenase (ubiquinone) Fe-S protein 4
Orthology
K03937  
NADH dehydrogenase (ubiquinone) Fe-S protein 4
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    664573 (Ndufs4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LG7
AA seq 190 aa AA seqDB search
MASIILRSRALQKCPSLKSLASISTTSSRQSDDVSKALNQKEAPQINDLALLNPEEVEQR
KRLQGYITVDATTDISCVTGVPEEHVKERLVRIYEPSKNAMQSGTDNTGHWEMDFDTRER
WENPLMGWCSTGDPLSNMKLQFSSKEDAIQYCEKNGWQWYVQESSFEKPFKPKSYGINFA
WNKRTRVSTK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgataattttgcgttcacgggcactccagaagtgccctagtttaaagtcactt
gctagtatttccacaacttcaagccgacaaagtgacgacgtttctaaagcacttaatcag
aaagaggccccacaaatcaacgatctagccttgcttaaccctgaagaagtcgaacaacgt
aaacgtttacagggttacataacagtggacgcaactactgatatttcatgcgtgacgggg
gtcccagaggagcacgtcaaggaacgcttggtgcgcatttatgagccgtctaaaaatgca
atgcaaagtgggactgacaacacaggacattgggagatggattttgacactcgcgagcgc
tgggagaaccctttgatgggctggtgttcgaccggtgacccattgtccaacatgaaactg
cagttttcaagcaaagaggacgcaatccagtactgtgagaaaaacggctggcagtggtac
gtccaggagagttcgtttgagaaaccgttcaagccaaagtcgtacggcattaattttgca
tggaacaagcgtactcgagtgtccaccaagtag

DBGET integrated database retrieval system