KEGG   Theobroma cacao (cacao): 108663033Help
Entry
108663033         CDS       T02994                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108663033
   00500 Starch and sucrose metabolism
    108663033
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     108663033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
8
AA seq 267 aa AA seqDB search
YGNFYASKSFFDPVKDRRILWGWANESDTPQDDVSKGWAGIQTIPRKVWLDPSRKQLLQW
PVEEIETLRSQNVRLREQKLKLGDRIEVEEITAAQADVDVTFSIPNLDKAEPFDPSWTNA
QELCSLKGSSVQGGVGPFGLLTLASQKLEEYTPVFFRVFKAQYKHVVLLCSEARSSSLRN
IGLYKPSFAGFVDVDLSEKKQLSLRSLIDHSVVESFGAGGKTCITSRVYPTLAVFGDAHL
FAFNNGTETIIVDLNAWSIRKPNKMNN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
tatgggaatttctacgcttcaaagtcattttttgaccctgttaaggacaggaggattcta
tggggttgggccaatgagtcggatacccctcaagatgatgtcagtaaaggatgggctggc
attcagacaattccaaggaaggtgtggcttgatcctagtaggaagcaattgctgcaatgg
cctgttgaagaaatagagactcttaggtcccagaatgttcgattaagagagcaaaagctc
aaattgggagatcgtattgaagtcgaagaaataactgctgcccaggctgatgttgatgtt
accttctccatacctaacttggacaaagctgagccatttgatcctagctggaccaatgcg
caggagctctgtagtctaaagggctcaagtgttcaaggtggcgttggaccatttgggcta
ctaacattagcttcacaaaagctagaagagtataccccagtttttttcagggtatttaaa
gcccaatacaagcatgttgttctcttgtgctctgaggctaggagttcttccttgaggaac
attgggctatacaaaccctcatttgctggatttgtggatgtggatttatctgagaagaag
cagctttctcttaggagtttgattgatcactctgttgtggagagttttggggctggtgga
aaaacttgcatcacatcaagagtttatccaacgctagcagtctttggcgatgctcacttg
tttgcattcaacaatgggactgagacaatcattgtagatcttaatgcttggagcataaga
aagcctaataagatgaacaactga

DBGET integrated database retrieval system