KEGG   Theobroma cacao (cacao): TCM_000237Help
Entry
TCM_000237        CDS       T02994                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein isoform 1
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
tcc  Theobroma cacao (cacao)
Brite
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TCM_000237
    1.3.1.94  polyprenol reductase
     TCM_000237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 456 aa AA seqDB search
MISPSERVAPCPWLCFTITIKKKSRLVAQLFYVQLQTQPSDPLLHPHRHVVPAHGYKNPA
SFSLICHCSAATTTPGRMEVVGVLVEAFSLRSMDTIKTCFIWLLRAGWVAGTLPILIASL
PSSRLGSFHTLLLGFAKRGKIMPSSSHKYTVPQSFFLHFYLLAVVWTTVLLMGIWWFAYE
VAPLSVESLSYSAAASHLTGGFHVFSLHKSRFASAEDRFNVWKSVFLLLLMEIHVLRRLY
ETLFVFNYSSSARMHIFGYFTGICFYIAAPLSLCTFCALEVVNFAADQVAEFKVEGQEML
SFTDFDLWGYVKPITRLGWCQWAGAAIFAWGWFHQYCCHAILVDASLCPDFGGLNEFNVG
KLILMGSLRGHRDQTVEYEIPLGDWFNIVSSPHYLAEMIIYVGLLVASGGTDFTIWLLLG
FVVANLAFAAAETHRWYLQKFEDYPPDRWAVLPFVY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatttccccaagtgaacgtgtggctccatgtccatggctttgtttcacgataacgatt
aagaagaagtcgagattagtggcccaattgttctatgttcaactacaaacccaaccgtcc
gacccacttttacaccctcaccgccacgtcgttccagctcacggttacaaaaatcctgcc
tcgttctctcttatttgccactgttcggcggcgactacaactccgggaagaatggaagtg
gttggagttttggtcgaagctttttctttgcggtcaatggacaccattaaaacgtgcttt
atttggcttcttagggcgggatgggtagccgggactcttcctatcctcatcgcttcactc
ccttcttcacgtctcggttcatttcatacccttttacttggatttgccaagaggggaaag
attatgccatcttcatcccataagtacacagttcctcagagtttctttctacacttttat
ttgttggctgtggtttggacaacagtgttgttaatgggaatttggtggtttgcatacgaa
gttgctcctttaagtgttgagtcattgagctactctgctgctgctagtcacttaactgga
gggtttcatgttttttccttgcacaagtctcggtttgcctcggctgaagacagattcaat
gtttggaagtctgtgttcttgctgttgttgatggaaattcatgtcctgaggcgcctttat
gagacgctttttgttttcaactacagctcatctgctcgaatgcacatttttggatacttc
actggcatttgtttttatatagcagcacctttgtcactctgtacattttgtgcactagag
gtcgttaattttgcagctgatcaagtggctgaatttaaggtcgaagggcaagaaatgctg
tcatttacagattttgatttgtggggatatgtcaagcctatcacaaggcttggatggtgc
caatgggctggtgctgctatatttgcttggggatggttccatcaatattgttgtcatgca
attcttgtagatgcatccttgtgtcctgattttggaggattaaatgaattcaatgtggga
aaactgatattgatgggttcacttagaggacatagagatcaaacagttgaatatgagatt
ccacttggtgattggttcaacatcgtctcaagtccacactatctggctgagatgataata
tatgtcggtctgttggttgcaagtggaggaactgacttcactatatggctgctccttgga
tttgtggtggctaatcttgcatttgctgcagcagaaactcaccggtggtacctccagaag
tttgaggactatccacctgaccggtgggccgttcttccatttgtttattag

DBGET integrated database retrieval system