KEGG   Theobroma cacao (cacao): TCM_011892Help
Entry
TCM_011892        CDS       T02994                                 

Definition
Phosphoenolpyruvate carboxylase 4 isoform 1
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCM_011892
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TCM_011892
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TCM_011892
Enzymes [BR:tcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TCM_011892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1060 aa AA seqDB search
MTDTTDDIAEEISFQSFEDDCKLLGNLLNDVLQREVGGQFMDKLERNRLLAQSASNMRLS
GIEDMAELLEKQLASEISKMTLEEALTLARAFSHYLNLMGIAETHHRVRKGRNVTHLSRS
CDDIFNQLVQGGISPNDLYNTVCKQEVEIVLTAHPTQINRRTLQYKHIRIAHLLEYNDRP
DLGHEDREMLIEDLMREITSIWQTDELRRHKPTPVDEARAGLNIVEQSLWKAIPHYLRRV
SNALKKHTGKPLPLTCTPIKFGSWMGGDRDGNPNVTAKVTRDVSLLSRWMAIDLYIREVD
SLRFELSMNQCNDRLSRLAHEILEKETSSEDLHESRNQPLSRSQFKLHGQQAPSLPTQLP
ARADLPACTDYNDGGSQYPKLEFPRTDYMPLSRQDGQGSSSSEISSKDSSENLRKLLANG
SVSNSNGSQSAVTPRCSFSSGQLLAQRKLFAESQIGRSSFHKLLEPSSSLRPGIAPYRIV
LGDVKEKLMKTRRRLELLLEDLPCEYDPWDYYETTDQLLEPLLQCYESLQSCGAGILADG
RLADLIRRVVTFGMVLMKLDLRQESGRHAETLDAITRYLDMGTYSEWDEEKKLEFLTKEL
KGKRPLVPPTIEVAPDVKEVLDTFRVAAELGSDSLGAYVISMASNASDVLAVELLQKDAR
LAVSGELGRPCPGGTLRVVPLFETVKDLRGAGSVIRKLLSIDWYREHIIKNHNGHQEVMV
GYSDSGKDAGRFTAAWELYKAQGDVVAACNEFGIKVTLFHGRGGSIGRGGGPTYLAIQSQ
PPGSVMGTLRSTEQGEMVQAKFGLPQTAIRQLEIYTTAVLLATLRPPQPPREQKWCNLME
EISKISCQNYRSTVYENPDFLAYFHEATPQAELGFLNIGSRPTRRKASTGIGHLRAIPWV
FAWTQTRFVLPAWLGVGAGLKGVCEKGHTEDLKAMYKEWPFFQSTIDLIEMVLGKADFPI
AKHYDEVLVSESRRELGAELRRELMMTEKYVLVVSGHEKLSENNRSLRRLIESRLPYLNP
MNMLQVEVLRRLRCDDDNKQLRDALLITINGIAAGMRNTG
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgacggacacgacggacgatatagcggaggaaatctcatttcagagcttcgaggatgac
tgtaagctgctggggaatctgctcaacgatgtcttgcagagagaagtaggcggccagttt
atggacaagctcgagaggaatcggctcctcgctcagagtgcttctaatatgcggttgtcc
gggatagaggatatggcagagttgctagagaagcagctagcatctgagatatcgaagatg
acattagaggaagccttgacattggctcgtgcttttagccattacctcaatttgatggga
atcgctgagacccatcacagggttcgtaaggggagaaatgttacacatctatcaagatct
tgtgatgacattttcaaccagttggttcagggtggcatttctccaaatgacctttataac
actgtttgcaagcaggaggttgagattgttcttactgcacatcccacccaaattaaccga
cgtaccttacaatataaacatataagaattgctcatctgttagaatacaatgaccgacct
gatcttggtcatgaagatcgagaaatgctaattgaagatctgatgagagagataacatct
atatggcagactgatgaacttagacgccacaaacctactcctgtagatgaagccagggct
ggtttgaacattgtggagcaatccctttggaaagctatacctcattacttacgtcgtgtt
agcaatgctctaaagaaacatacaggaaagccacttccactaacatgcaccccaataaag
tttggttcttggatggggggtgatagggatggaaatcctaatgtcacagcaaaggtaacg
agggatgtctcacttttgtctaggtggatggccattgatctgtacatccgtgaagttgat
agccttagatttgaactatccatgaaccaatgcaatgataggttatccagattggctcat
gaaattctagaaaaagaaacctcatcggaggacctgcatgagagtcggaaccaaccttta
agccgaagtcaattcaagcttcatggccaacaagctccatcccttcctacccaacttcca
gctagagcagatctacccgcctgcactgattacaatgatggtggatctcagtatccaaaa
ctagaattccccaggactgattacatgccattaagtcgtcaggatggtcagggctcttct
agttcagaaatttcatcgaaggattctagtgaaaatctacgcaaattattggcaaatgga
agtgtttctaactccaacgggtcacaatcagctgtcacgccacgctgttctttctcctct
ggtcagcttctagctcagaggaaattatttgcagaatctcagataggaaggtccagcttc
cataagcttcttgagccaagttcgtctctacgtcctggaattgctccctatcgaatcgtt
cttggagatgtcaaggaaaagctcatgaaaacacgaagacggctggaacttcttctggag
gatcttccctgtgaatatgatccttgggattactatgaaacaacagatcaacttctggaa
ccgctgcttcaatgttatgagtctctgcaatcatgcggggccgggatattagcggatggt
cggcttgctgacctgattcggagagttgtcacctttggaatggtgttaatgaagcttgat
ttgcgtcaggaatctggtaggcacgctgaaacacttgatgcaattaccagatatttggat
atgggtacttatagtgagtgggatgaagaaaagaaacttgagtttttgacaaaagagcta
aaggggaagcgaccactagttcctcctactatagaggttgctcctgatgttaaagaagtg
ttagataccttccgcgttgctgccgaactaggaagtgattctcttggagcatatgtgata
tctatggcatccaatgcaagcgatgtccttgctgtggagcttctgcagaaagatgctcga
cttgctgttagcggggaattagggagaccatgtcctggtggaacgttgcgtgtggttccc
ctgtttgaaactgtaaaggacctcagaggagcaggttcagtgatcagaaaattattatca
attgactggtatcgggagcacattataaagaaccataatgggcatcaagaagtgatggtt
ggatattctgattcgggtaaagatgctgggcgcttcactgctgcatgggagctttacaaa
gcccaaggggatgttgttgctgcttgcaatgagtttggaatcaaagttactcttttccat
ggccgaggagggagtattggtcgtggtggtggtccaacataccttgccattcagtcccaa
ccacctggttctgtaatgggcacacttcgctcgacagagcaaggggagatggtgcaggcg
aaatttggtttgccacagactgccattagacagctagaaatatacacaactgctgtgctc
ctcgcaactctgcgtcccccgcaaccacctcgagaacaaaaatggtgtaatctcatggag
gagatctcaaaaatcagttgccagaattaccgaagcacagtgtatgaaaatccagatttc
cttgcctacttccatgaggctacaccccaggctgaactgggctttcttaacataggaagc
cgccctacaagaagaaaggcctcaacaggaatcggacatcttcgagctattccatgggta
tttgcatggacccagaccagatttgttcttccagcttggcttggtgttggagctggttta
aagggtgtttgtgagaagggtcacacagaggacttgaaagccatgtacaaagaatggcca
tttttccaatctacaatcgaccttatagagatggttttaggaaaggccgattttccaata
gccaagcattacgatgaagtgctagtgtctgagagcaggcgggaactgggtgcggaactt
aggagggagctgatgatgacagaaaagtatgtattggtggttagtggacatgagaaacta
tctgagaacaatcgaagcttgagaaggctgatagagagcaggctcccgtatctcaacccc
atgaacatgttgcaagtggaggttcttaggaggcttagatgtgatgatgataacaaacaa
cttagagatgcattgctaattactataaatggaattgcagcagggatgaggaacaccggt
taa

DBGET integrated database retrieval system