KEGG   Theobroma cacao (cacao): TCM_015896Help
Entry
TCM_015896        CDS       T02994                                 

Definition
Ubiquitin C-terminal hydrolase 3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tcc  Theobroma cacao (cacao)
Brite
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TCM_015896
Peptidases [BR:tcc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TCM_015896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 236 aa AA seqDB search
MATPDESPSAKRWLPLEANPDVMNQFLWGLGLPEDEAECCDVYGLEDELLAMVPQPVLAV
LFLFPITSQTEEERLEQENEKRDASNKVYFMKQTVGNACGTIGLLHSVGNITSEIKLQEG
SFLDRFFKSTASMDALERAAFIEKDREMEVAHSVAATAGETEASDNVDTHFICFTCVDGE
LYELDGRKSGPISHGASSPSSLLQDAAKVIRGMIQKNPESLNFNVIALSKKVGGGF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgccagacgaaagtccttctgctaagagatggcttcctctcgaagctaacccc
gatgtcatgaaccagtttctttggggcctgggtcttccagaggatgaggcagagtgctgc
gatgtttacggcttggaggatgaactcttagctatggtcccacagcctgttcttgctgtg
ctttttctttttccaataacttctcagactgaagaagagagattggagcaggaaaatgag
aagagggatgctagcaacaaagtttatttcatgaaacaaactgtgggaaatgcttgtgga
acgattgggcttcttcattctgttggaaatatcacttcagaaatcaagcttcaagaggga
tcatttttagataggtttttcaaatctactgcaagcatggatgcattggagcgtgcagca
tttattgagaaagacagagaaatggaagtggctcactcagttgcagctacagctggtgaa
acagaggcttctgacaatgtggacactcactttatctgcttcacttgtgttgatggggaa
ctttatgagcttgatggaaggaagtcaggaccaatatctcatggtgcttcctcaccaagt
agcttattgcaggatgcggccaaagtcatacggggcatgatccagaaaaatcccgagtca
ctcaacttcaatgttattgcactttctaagaaagtggggggtggattttaa

DBGET integrated database retrieval system