KEGG   Theobroma cacao (cacao): TCM_016139Help
Entry
TCM_016139        CDS       T02994                                 

Definition
Leucoanthocyanidin dioxygenase isoform 1
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    TCM_016139
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.19  leucocyanidin oxygenase
     TCM_016139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 379 aa AA seqDB search
MTTALTQTLVELITYHYKKATKDQHYGIFLRVRVESLASSGIQSIPKEYIRPQEELTSIG
NVFEEEKKEEGPQVPTIDLKEIDSEDREVRERCRQELKKAATEWGVMHLVNHGISDELME
RVKKAGQKFFELSVEEKEKYANDQALGKIQGYGSKLANNASGQLEWEDYFFHLVYPEDKR
DLSIWPQTPSDYTEVTSEYARQLRVLASKILSALSLCLGLEEGRLEKEVGGLEELLLQMK
INYYPKCPQPELALGVEAHTDVSALTFILHNMVPGLQLFYEGKWITAKCVPNSIIMHIGD
TVEILSNGKYKSILHRGLVNKEKVRISWAVFCEPPKEKIILKPLPETVSETEPPLFPPRT
FAQHIHHKLFRKTQDGLSN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgctctaactcagaccttggtggagctcatcacgtatcattataaaaaggcc
actaaagatcagcactacggcatattcttgagagtgagagtagagagcttggcaagcagt
gggattcagtccatcccgaaggagtacattagacctcaggaagagcttacaagcattggt
aatgtgtttgaagaagagaaaaaagaggaagggcctcaggttccaaccattgatttaaag
gaaattgactcagaggacagagaggtacgggagagatgtcgccaggagttgaagaaagct
gccacggagtggggtgtgatgcaccttgttaaccatgggatctcggacgagctcatggaa
cgtgtcaagaaagctggacagaagttctttgaactttctgtcgaggagaaagagaagtat
gccaacgaccaggctttggggaagattcaggggtatggcagcaagctagctaacaatgct
agtggtcagcttgagtgggaggactacttcttccatcttgtgtatcccgaggacaagaga
gacttgtccatctggcctcaaacaccaagcgactacactgaagtcacaagtgagtacgca
aggcaactccgagtccttgcgagcaaaattctttcggcactatcactttgcttaggattg
gaagaaggaaggctagagaaggaagttggtggattggaagagctccttcttcaaatgaaa
atcaattactatcccaaatgccctcaaccagaactcgctctcggtgtggaagctcacaca
gatgtaagtgcacttaccttcattctccacaacatggtccctggcctgcaacttttctac
gaaggcaagtggatcaccgcaaaatgtgttccaaactccatcatcatgcacattggtgac
accgtcgagatcctcagcaatggtaagtacaagagcattcttcacaggggtctggttaac
aaggagaaggttaggatctcatgggcagttttctgtgagccgccaaaggagaagatcatt
ctcaagccactgccagagactgtgtccgagacggagcctccgttgttccctcctcgcacc
tttgctcagcatattcaccacaagctgtttaggaagacccaggatggcctgtctaattga

DBGET integrated database retrieval system