KEGG   Theobroma cacao (cacao): TCM_021771Help
Entry
TCM_021771        CDS       T02994                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Castasterone biosynthesis, campesterol => castasterone
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    TCM_021771
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TCM_021771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 261 aa AA seqDB search
MPRDSDQPLFHYSLLGLYLIVLPTWISLKFIQAPYGKHNRPGWGPTLSPSLAWFLMESPT
LWLTVLLFPFGRHFSNPKSFILMSPYLFHYFNRTVLYPLRLSRSSNGQARSFPVSIALMA
FGFNLLNAYLQARWVSHYKDDYENDKLFWLRFLVGLLVFIAGMWVNVWADSVLVGLKKQG
GGGYKVPRGGLFDLVSCPNYFGEIMEWLGWAVMTWSCVGFGFFLYTCANLVPRARASRRW
YLEKFKDDYPKHRKAVIPFLY
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcccagagactcagatcagcccctttttcactacagcctcctcggtctctacctcatc
gtcctaccgacatggatcagcctcaagttcattcaggccccttacggcaagcacaaccgc
cctggatgggggccaaccctgtctccatctttggcttggttcctcatggaaagccccacc
ctttggctcactgtcttgctctttcctttcggccgacacttttccaacccgaaatcgttc
attctgatgtctccttatctcttccactatttcaaccgtacagtgctttaccctcttcgc
ctgtcacgcagcagcaacggccaagccaggagttttccggtgagtatagctctcatggct
ttcgggtttaatctcttgaatgcttatctgcaagccaggtgggtgtctcactacaaggat
gattatgaaaacgacaagctgttttggctgagattccttgtcggattgctggtttttatt
gctggcatgtgggtgaatgtttgggctgatagcgtcctggtggggcttaaaaagcagggt
ggtggcggatacaaggttccaagaggggggttgttcgacttggtgagctgccctaactac
tttggggagatcatggagtggttgggctgggcggtgatgacatggtcctgcgtggggttt
gggttctttctctacacctgtgccaacctggtgcctagagctcgtgccagccgccgctgg
tatttggagaagttcaaggacgattaccccaagcacagaaaagctgtgatcccatttctc
tattga

DBGET integrated database retrieval system