KEGG   Theobroma cacao (cacao): TCM_024461Help
Entry
TCM_024461        CDS       T02994                                 

Definition
Ubiquitin carboxyl-terminal hydrolase isozyme L5 isoform 1
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
tcc  Theobroma cacao (cacao)
Brite
Enzymes [BR:tcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TCM_024461
Peptidases [BR:tcc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TCM_024461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 334 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDLDAVNNLRPVYGLIFLFKWRPGEKDE
RLVIKDPNPNLFFASQVINNACATQAILSILMNCPDIDIGPELSKLKEFTKNFPPELKGL
AINNSEAIRTAHNSFARPEPFVPEEQKAAGKDDDVYHFISYIPVDGVLYELDGLKEGPIS
LGQCPTGQGDMEWMKMVQPVIQERIERYSKSEIRFNLMAVIKNRKEMYTAELKELQKKRE
RILQQLATIQSDRLADRSSFEALNKQLSEVNSGIEGATEKILMEEEKFKKWRTENIRRKH
NYIPFLFNFLKILAEKKQLKPLIEKAKQKTSSSR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgcacgattgaatccgatcccggtgtttttacagaacttatacagcagatg
caagttaaaggcgtacaagtagaggagttgtattcattggatcttgatgctgtaaacaat
cttaggcctgtgtatgggttgattttccttttcaaatggcgcccaggggagaaggatgaa
cgtcttgtaattaaggacccaaaccctaatttattctttgctagtcaggtcatcaataat
gcttgtgctacacaagcaatattgtctatcctcatgaactgcccagatattgacattggc
ccagaactttcaaagttgaaagagttcactaaaaactttcctccagagctcaagggtctg
gctataaataacagtgaagctatacgtacagcccataatagctttgcaaggcctgagcct
tttgtcccagaggagcagaaagctgctgggaaagatgatgatgtctaccatttcataagc
tacatacctgttgatggggtactctatgagcttgatggattgaaggagggacccattagc
cttggtcagtgccctactggccaaggagatatggaatggatgaagatggtgcaaccagta
atccaagaacgtattgagagatattcgaaaagtgaaataagattcaacctcatggcagtt
atcaagaacaggaaagagatgtacactgctgaacttaaggagctccaaaagaagagggaa
cgcatcttgcagcagctggctaccatacagtcggacagactggcagacagaagcagcttt
gaagcactaaacaaacaactttcagaagtaaattcagggattgagggtgccactgagaag
attttgatggaggaggagaaattcaagaagtggaggactgaaaatattcgcaggaaacac
aactacatacccttcttgttcaacttccttaaaattcttgctgaaaagaagcaattgaaa
ccccttattgagaaagctaagcagaaaactagcagctctaggtga

DBGET integrated database retrieval system