KEGG   Theobroma cacao (cacao): TCM_025799Help
Entry
TCM_025799        CDS       T02994                                 

Definition
NADH:cytochrome B5 reductase 1 isoform 1
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TCM_025799
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TCM_025799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 280 aa AA seqDB search
MDLEFLQSVDVQILVGVAVAVLAIGVGAAYLFSSRKSKGCLDPENYKEFKLVKRQQLSHN
VAKFTFALPTPTSVLGLPIGQHISCRGKDSQGDEVIKPYTPTTLDSDVGSFELVIKMYPQ
GRMSHHFREMRVGDYLSVKGPKGRFRYQPGQVRAFGMIAGGSGITPMFQVARAILENPKD
TTNVHLIYANVTCEDILLKEELDSLVARYPGRFKVYYVLNQPPEVWDGGVGYVSKEIIQI
HCPAPAPDIQILRCGPPPMNKAMAGHLDALGYSPEMQFQF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatttggaattcttgcaatctgtggatgttcagattcttgttggtgtagctgtagcg
gttttagccattggcgttggtgctgcttatctgttttcctctaggaaatccaaaggctgt
ctagatcctgagaattacaaagagtttaaacttgtcaaacgacagcagctgagccataat
gtggcaaagttcacatttgcacttcctactcctacttcggttttgggtcttcccattgga
cagcatataagttgcaggggcaaggatagccaaggtgacgaagttattaaaccatataca
cctacaacattggattcagatgttggttcttttgaattagttattaagatgtatcctcaa
gggaggatgtcacaccatttcagagagatgcgtgttggtgattacctttctgtgaaagga
cccaaggggcggttcaggtatcaacctggtcaagttagggcatttgggatgattgctgga
ggctctggcattactccaatgttccaagtagccagagccatattggagaacccgaaagac
acaactaatgtacaccttatttatgcaaatgtcacatgtgaggacattcttttaaaggaa
gaattggatagccttgttgccaggtaccctggtcgcttcaaagtctactatgttttgaac
cagcctcctgaagtgtgggatggtggtgtcggctatgtgtcaaaggaaattattcaaatt
cactgccctgcaccggcacctgatatccagattctaaggtgtggcccaccacccatgaac
aaggccatggctggacaccttgacgcccttggatattcacctgagatgcagttccagttc
tga

DBGET integrated database retrieval system