KEGG   Theobroma cacao (cacao): TCM_027198Help
Entry
TCM_027198        CDS       T02994                                 

Definition
(RefSeq) Fatty acid desaturase 5
  KO
K20416  
palmitoyl-[glycerolipid] 7-desaturase [EC:1.14.19.42]
Organism
tcc  Theobroma cacao (cacao)
Brite
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.42  palmitoyl-[glycerolipid] 7-desaturase
     TCM_027198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 386 aa AA seqDB search
MAFVTSLLSKPKYLDVSPPQRATTMKTRSCSCKVLNFGHQNPKFNQINGEQSPLHASFIT
RLNRSYSNRKVLALANGVSVEANEPDPEGKISGRILLSNVVVQRKKKAFWGRKWNTSDMA
IAGVIVSMHLLSLFAPFHFNWPAFWLAVGLYVVTGLLGITLSFHRNLSHRSFKVPKWLEY
FFAYCGVQALQGNPISWVSTHRYHHQFCDSNRDPHSPIEGFWFSHMSWLFDTNTVIEKCG
EPTNVGDLRQQPFYKFLEGTYILHPIALGVLLYALGGFPFIVWGMGVRIVWLYHITWLVN
SACHVWGKQAWNTGDLSRNNWWMALLSFGEGWHNNHHAFKYSARHGLEWWQLDMTWCVIK
FLQVIGLATEVKLPTEVQKKRMAFSS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgtcacatcgttattgtcaaagccaaagtacttagatgtatcacctcctcaa
agagcgacaacaatgaaaaccagatcttgctcttgcaaagtcttaaactttggccatcaa
aacccaaaattcaatcaaataaacggagagcagagtcctctgcatgcgagttttatcact
cgtttgaataggagttacagcaataggaaagtgttggcattggctaatggggtgtcagtt
gaagcaaacgagcccgacccagaagggaaaatctcgggtagaattttgttatctaatgtg
gtggtgcaaaggaagaaaaaggcattttggggaagaaaatggaacacttcggatatggcc
attgctggtgttattgtaagcatgcatttgctaagcctttttgcaccttttcatttcaat
tggcccgccttttggcttgctgtgggactctatgtggtgacaggacttctagggattaca
ttgtcttttcataggaatctttctcatagaagcttcaaggttccaaaatggcttgagtac
ttctttgcttattgtggagttcaggcacttcaggggaatccaattagttgggtaagcaca
cataggtaccaccaccaattttgtgattctaacagagacccccatagccctattgaagga
ttttggttcagccacatgagctggctctttgataccaacaccgttattgaaaagtgtgga
gaaccaaccaatgttggggatctacggcagcaacccttctacaagtttcttgagggtacc
tacattcttcatccaattgcacttggagttttgctatatgctctaggagggtttcccttc
attgtttggggaatgggtgtgaggattgtatggctttaccacatcacttggctggtaaat
tcagcttgccatgtgtgggggaagcaagcatggaatactggtgatttgtccaggaacaat
tggtggatggcattgctttcatttggagagggttggcataataaccaccatgctttcaaa
tactcagccagacatggtctggaatggtggcaactggacatgacttggtgtgtaatcaaa
tttcttcaagttattggactggcaactgaggttaagctacctactgaagttcagaagaaa
aggatggctttcagcagctga

DBGET integrated database retrieval system