KEGG   Theobroma cacao (cacao): TCM_027198Help
Entry
TCM_027198        CDS       T02994                                 

Definition
Fatty acid desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TCM_027198
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TCM_027198
Enzymes [BR:tcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TCM_027198
Lipid biosynthesis proteins [BR:tcc01004]
 Desaturase
  First
   TCM_027198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 386 aa AA seqDB search
MAFVTSLLSKPKYLDVSPPQRATTMKTRSCSCKVLNFGHQNPKFNQINGEQSPLHASFIT
RLNRSYSNRKVLALANGVSVEANEPDPEGKISGRILLSNVVVQRKKKAFWGRKWNTSDMA
IAGVIVSMHLLSLFAPFHFNWPAFWLAVGLYVVTGLLGITLSFHRNLSHRSFKVPKWLEY
FFAYCGVQALQGNPISWVSTHRYHHQFCDSNRDPHSPIEGFWFSHMSWLFDTNTVIEKCG
EPTNVGDLRQQPFYKFLEGTYILHPIALGVLLYALGGFPFIVWGMGVRIVWLYHITWLVN
SACHVWGKQAWNTGDLSRNNWWMALLSFGEGWHNNHHAFKYSARHGLEWWQLDMTWCVIK
FLQVIGLATEVKLPTEVQKKRMAFSS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgtcacatcgttattgtcaaagccaaagtacttagatgtatcacctcctcaa
agagcgacaacaatgaaaaccagatcttgctcttgcaaagtcttaaactttggccatcaa
aacccaaaattcaatcaaataaacggagagcagagtcctctgcatgcgagttttatcact
cgtttgaataggagttacagcaataggaaagtgttggcattggctaatggggtgtcagtt
gaagcaaacgagcccgacccagaagggaaaatctcgggtagaattttgttatctaatgtg
gtggtgcaaaggaagaaaaaggcattttggggaagaaaatggaacacttcggatatggcc
attgctggtgttattgtaagcatgcatttgctaagcctttttgcaccttttcatttcaat
tggcccgccttttggcttgctgtgggactctatgtggtgacaggacttctagggattaca
ttgtcttttcataggaatctttctcatagaagcttcaaggttccaaaatggcttgagtac
ttctttgcttattgtggagttcaggcacttcaggggaatccaattagttgggtaagcaca
cataggtaccaccaccaattttgtgattctaacagagacccccatagccctattgaagga
ttttggttcagccacatgagctggctctttgataccaacaccgttattgaaaagtgtgga
gaaccaaccaatgttggggatctacggcagcaacccttctacaagtttcttgagggtacc
tacattcttcatccaattgcacttggagttttgctatatgctctaggagggtttcccttc
attgtttggggaatgggtgtgaggattgtatggctttaccacatcacttggctggtaaat
tcagcttgccatgtgtgggggaagcaagcatggaatactggtgatttgtccaggaacaat
tggtggatggcattgctttcatttggagagggttggcataataaccaccatgctttcaaa
tactcagccagacatggtctggaatggtggcaactggacatgacttggtgtgtaatcaaa
tttcttcaagttattggactggcaactgaggttaagctacctactgaagttcagaagaaa
aggatggctttcagcagctga

DBGET integrated database retrieval system