KEGG   Theobroma cacao (cacao): TCM_032360Help
Entry
TCM_032360        CDS       T02994                                 

Definition
PfkB-like carbohydrate kinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tcc  Theobroma cacao (cacao)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tcc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TCM_032360
Enzymes [BR:tcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TCM_032360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 379 aa AA seqDB search
MKGITFSPSNNYSCYSKIQTDQTPRPIKSLTQFQFPLFNNKNQNQSSKNQPLLSFSVNSI
KNTQTPITQPPPLVVVGSANADIYVEIDRLPIEGETISAKNGQTLAGGKGANQATCGAKL
SYPTYFVGQVGDDAHGKLITEALGNGGVHLEYLKSLGGGVPTGHAVVMLQSDGQNSIIIV
GGANMSCWPDKLSDQDLDVVKKAGIVLLQREIPDSVNIQVAMAARSAGVTVIMDAGGMDA
PMPQELLNFVDILSPNESELGRLTGSSTESFEQISQAAAKCHKMGVKQVLVKLGAMGSAL
FVEGEEPIRQPIIPAAKVLDTTGAGDTFTASFAVALVEGKSKEQCLRFAAAAASLCVQVK
GAIPSMPDRKSVLKHLQSV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatcacattttcaccttcaaacaactacagttgctactccaaaatccaaacc
gatcaaacaccccgacccatcaaaagcttaacccaatttcaattcccattattcaacaac
aaaaaccaaaaccaatcaagcaaaaaccaaccacttctctcattttccgtaaactcaatc
aaaaacacccagaccccaataacccaaccgccacccttagtcgtagttggctcagccaat
gcagatatctatgtggaaatcgacagattacccatagaaggagagacaatatcagccaaa
aatggccaaactcttgcagggggcaaaggagccaaccaggcaacgtgtggagccaaactt
tcttacccgacatattttgtaggacaagtaggcgatgatgcacatgggaaattgataact
gaggcattgggaaatggtggggtccatttggagtatttgaagagtttgggtggtggtgtg
cctaccggtcatgctgtggtgatgttgcagtctgatgggcagaattctattatcattgtt
ggtggtgctaatatgagttgttggcctgacaaattgtctgaccaggatttggatgtggtt
aagaaggctggcattgttttgcttcagagggaaattcctgattctgtcaatattcaagtt
gctatggccgcaaggagtgcaggtgttaccgtaattatggatgctggtggaatggatgca
ccaatgccccaagaactgttgaattttgttgatatcttgagcccaaatgaatctgaactt
ggtcgattgaccggatcgtctactgaaagttttgagcagattagtcaagcagctgcaaaa
tgtcacaaaatgggtgttaagcaagttcttgtgaaacttggggccatgggatctgcttta
tttgtagaaggtgaggagccaatcagacagcctatcattccagctgcaaaagttctagat
acaacaggagctggtgatacttttactgcatctttcgcagtggctctggtagaggggaag
tccaaagagcaatgcttgagatttgctgcagcagcagcctctctttgtgttcaagtgaag
ggagccattcctagtatgcctgacaggaaatctgttttgaagcatcttcagtctgtatga

DBGET integrated database retrieval system